DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and OSBP2

DIOPT Version :9

Sequence 1:NP_001286672.1 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_110385.1 Gene:OSBP2 / 23762 HGNCID:8504 Length:916 Species:Homo sapiens


Alignment Length:245 Identity:48/245 - (19%)
Similarity:82/245 - (33%) Gaps:45/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKTSLATQTNGTAENGNCFDILKVSNLFETSLLDEDDVQLDAYLAAYEE--------IMKFFQLM 58
            :||.|....:||....:....|...:.||..||     :...||..|:.        ::.:::..
Human   158 AKTPLGVPMSGTGTTSSAPLALLPLDSFEGWLL-----KWTNYLKGYQRRWFVLGNGLLSYYRNQ 217

  Fly    59 GSV---------FSFVSSDVRSKIDIL-------YALRAKDAEEQEHFNTFRTMLDYEKEAQLLT 107
            |.:         .|....|......||       |.|:|....:::.:.| ...|...|..:::.
Human   218 GEMAHTCRGTINLSTAHIDTEDSCGILLTSGARSYHLKASSEVDRQQWIT-ALELAKAKAVRVMN 281

  Fly   108 QKGYVSGSRTLLRLHRGLDFVYEFLNRIQAIPDDQKTVDVCKEAYDDTLGKHHSFLIRKGARLAM 172
            .....||.............::..|..:....||..|   |    :|.:.||.:.|.|....|..
Human   282 THSDDSGDDDEATTPADKSELHHTLKNLSLKLDDLST---C----NDLIAKHGAALQRSLTELDG 339

  Fly   173 YAMPTR-GDLLKKVCSDVEAAKENLPSMLKHMRTNYDRTEDLYTLYDLHS 221
            ..:|:. |:.||.|.......:....:|:...|       |...|.::||
Human   340 LKIPSESGEKLKVVNERATLFRITSNAMINACR-------DFLELAEIHS 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_001286672.1 GLTP 42..186 CDD:285880 31/168 (18%)
OSBP2NP_110385.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..121
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..163 2/4 (50%)
PH_OSBP_ORP4 185..280 CDD:270101 18/100 (18%)
PH 186..274 CDD:278594 16/93 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..301 2/18 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 417..448
Oxysterol_BP 522..896 CDD:279564
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 813..842
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.