DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and Plekha8

DIOPT Version :9

Sequence 1:NP_001286672.1 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001157833.1 Gene:Plekha8 / 231999 MGIID:2681164 Length:519 Species:Mus musculus


Alignment Length:210 Identity:56/210 - (26%)
Similarity:94/210 - (44%) Gaps:34/210 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ETSLLDEDDVQLDAYLAAYEEIMKFFQLMG-SVFSFVSSDVRSKIDILYALRAKDAEEQEHFNTF 93
            :..||::..:..:|:||:...::.....:| :||:.|..|:...|.   .:..|....:|.|.|.
Mouse   321 DIELLEDSGIPTEAFLASCYAVVPVLDKLGPTVFAPVKMDLVGNIK---KVNQKYITNKEEFTTL 382

  Fly    94 RTMLDYEKEAQLLTQKGYVSGSRTLLRLHRGLDFVYEFLNRIQAIPDDQKTVDVCKEAYDDTLGK 158
            :.::.:|.||.:...:.  |.:..||.|.|||.|:..||..::....|.:|  ....||..||.:
Mouse   383 QKIVLHEVEADVAQVRN--SATEALLWLKRGLKFLKGFLTEVKNGEKDIQT--ALNNAYGKTLRQ 443

  Fly   159 HHSFLIRKGARLAMYAMPT-----------RGDLLKKVCSDVEAAKEN-----LPSMLKHMRTNY 207
            ||.:::|....||:.|.|:           .||..|:..|   |..:.     ||:|.|.:..  
Mouse   444 HHGWVVRGVFALALRAAPSYEDFVAALTIKEGDHQKEAFS---AGMQRDLSLYLPAMEKQLAI-- 503

  Fly   208 DRTEDLYTLYDLHSL 222
                 |.|||::|.|
Mouse   504 -----LDTLYEIHGL 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_001286672.1 GLTP 42..186 CDD:285880 42/155 (27%)
Plekha8NP_001157833.1 PH_FAPP1_FAPP2 1..100 CDD:269951
PH 1..93 CDD:278594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..302
Glycolipid transfer protein homology domain 330..473 39/149 (26%)
GLTP 333..470 CDD:285880 39/143 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.