DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and tag-296

DIOPT Version :9

Sequence 1:NP_001286672.1 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001380241.1 Gene:tag-296 / 172997 WormBaseID:WBGene00018632 Length:226 Species:Caenorhabditis elegans


Alignment Length:205 Identity:64/205 - (31%)
Similarity:111/205 - (54%) Gaps:10/205 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILKVSNLFETSLLDEDDVQLDAYLAAYEEIMKFFQLMGSVFSFVSSDVRSKIDILYALRAKDAEE 86
            |::.|::.....:..|||:|..::..|||:.||..::|.:|.||..|||.|||:|..|...:   
 Worm    27 IVEKSDVENCPEVTPDDVELLTFVEVYEELCKFIGMLGKIFEFVEKDVREKIDLLKELHTAN--- 88

  Fly    87 QEHFNTFRTMLDYEKEAQLLTQKGYVSGSRTLLRLHRGLDFVYEFLNRIQAIPDDQKTVDVCKEA 151
            .|.:.|...::..||.   :.:.|..||:..:|.|:|.|:|:.||:....|..:|.....:|||.
 Worm    89 PEGYKTVVALVHSEKP---MEKNGKESGAVAILHLNRALEFIVEFMYAAVAATNDDSIPKICKEC 150

  Fly   152 YDDTLGKHHSFLIRKGARLAMYAMPTRGDLLKKV----CSDVEAAKENLPSMLKHMRTNYDRTED 212
            ||.||.|||.::||...::|:|.:|||..:|..:    .:|....:..:..::.|.:..:.|...
 Worm   151 YDGTLAKHHPWIIRTAVKVAVYTLPTREKMLDYLKAGSVTDESLIRVLIDDVVSHGKIVHSRINT 215

  Fly   213 LYTLYDLHSL 222
            :||:::||.:
 Worm   216 IYTVHELHKI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_001286672.1 GLTP 42..186 CDD:285880 51/147 (35%)
tag-296NP_001380241.1 GLTP 49..181 CDD:400867 50/137 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4288
eggNOG 1 0.900 - - E1_KOG4189
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11550
Inparanoid 1 1.050 117 1.000 Inparanoid score I3368
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49248
OrthoDB 1 1.010 - - D1423493at2759
OrthoFinder 1 1.000 - - FOG0002959
OrthoInspector 1 1.000 - - oto19711
orthoMCL 1 0.900 - - OOG6_104617
Panther 1 1.100 - - LDO PTHR10219
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1338
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.