DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and gltpd2a

DIOPT Version :9

Sequence 1:NP_001286672.1 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_001342223.1 Gene:gltpd2a / 100002437 ZFINID:ZDB-GENE-110411-68 Length:299 Species:Danio rerio


Alignment Length:238 Identity:68/238 - (28%)
Similarity:116/238 - (48%) Gaps:38/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NGNCFDILKVSNLFETSLLDEDDVQLDAYLAAYEEIMKFFQLMGSVFSFVSSDVRSKIDILYALR 80
            ||..|.:.::.....::|....||.||.||..:||::||.:.:|.:..|.:..|..||.::..|.
Zfish    70 NGQKFQVSRLLLHLNSALGPASDVLLDPYLLCWEELIKFMEALGPLVGFFTHKVEEKIALIRQLS 134

  Fly    81 AKDAEEQ------------EH--------FNTFRTMLDYEKEAQLLTQKGYV-------SGSRTL 118
            .:::...            :|        :::..:||    ||:|  |:|.|       ||||||
Zfish   135 LEESTRHSVTASNSMMYGAQHEAPPPGHAYHSVHSML----EAEL--QRGVVSFDQQTPSGSRTL 193

  Fly   119 LRLHRGLDFVYEFLNRIQAIPDDQKTVDVCKEAYDDTLGKHHSFLIRKGARLAMYAMPTRGDLLK 183
            |||||.|.::...|.::....:.:...::|:|||.:.|..||.:|:::.|.|..:|||.|...|:
Zfish   194 LRLHRSLLWLQLLLEKLGTEREGRSFGELCREAYLEVLAPHHPWLVQRAAELVFHAMPDRSVFLQ 258

  Fly   184 KVCSDVEAAKENLPSM---LKHMRTNYDRTEDLYTLYDLHSLP 223
            .||  |...:|..|.|   :..:|..:.||:....:.::..||
Zfish   259 LVC--VRTQEEAEPVMRIVVAAIREIHQRTQRELEIRNMLDLP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_001286672.1 GLTP 42..186 CDD:285880 50/170 (29%)
gltpd2aXP_001342223.1 GLTP 96..262 CDD:285880 52/173 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582026
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4189
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1423493at2759
OrthoFinder 1 1.000 - - FOG0002959
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10219
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1338
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.