| Sequence 1: | NP_724707.1 | Gene: | CG30357 / 246563 | FlyBaseID: | FBgn0050357 | Length: | 451 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_648614.1 | Gene: | CG10752 / 39467 | FlyBaseID: | FBgn0036325 | Length: | 539 | Species: | Drosophila melanogaster | 
| Alignment Length: | 410 | Identity: | 90/410 - (21%) | 
|---|---|---|---|
| Similarity: | 167/410 - (40%) | Gaps: | 92/410 - (22%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    80 NTLKERTLFSLGYSTAGLLKKSKISKVLKGKVNLYQQIVSLVKQRTKTNSEITIGKTSHPVHLMV 144 
  Fly   145 LQSFSRMFRDMGNDLS----VALPEKMITPRSFGLIYEWMIEDTPVLPRLGLLEVFHAAKFME-I 204 
  Fly   205 PQLVRQCKYCLDH-GFTEDSAAMLYFEAKILKLEVIHLQYLERVSKFFLTLVASKEFLRLPLKSM 268 
  Fly   269 LLLIQSDLIGVNTELEVFMAAARWLSHHWPQREENVTDVVSSIRFGLIPPWLLIRLQ------KP 327 
  Fly   328 DVTSVGVGRIVAQPIVRQAIHEGIAYTTTRMFYGKDREAFKHYLHKACVKP-------------- 378 
  Fly   379 PVQRTWIYDRKCPYHHRMQCRNTVDLTYDAFLEYLNYTQ------------RQHRDYWKSLEPVD 431 
  Fly   432 ASNVCFSCQAKKS--DLTKP 449 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG30357 | NP_724707.1 | BTB | 131..217 | CDD:197585 | 23/90 (26%) | 
| BTB | <139..211 | CDD:295341 | 21/76 (28%) | ||
| BACK | 226..323 | CDD:285009 | 27/96 (28%) | ||
| DUF4734 | 337..427 | CDD:292506 | 19/115 (17%) | ||
| CG10752 | NP_648614.1 | BACK | 172..264 | CDD:197943 | 26/91 (29%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45469502 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0006713 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR22667 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.940 | |||||