DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30357 and CG10752

Sequence 1:NP_724707.1 Gene:CG30357 FlyBaseID:FBgn0050357 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_648614.1 Gene:CG10752 FlyBaseID:FBgn0036325 Length:539 Species:Drosophila melanogaster

Alignment Length:410 Identity:90/411 (22%)
Similarity:167/411 (41%) Gaps:92/411 (22%)


  Fly    80 NTLKERTLFSLGYSTAGLLKKSKISKVLKGKVNLYQQIVSLVKQRTKTNSEITIGKTSHPVHLMV 144
            |.|||...::       :|:.:...|    |:.|.:::...:::....::.|.:..|.:...:.|
  Fly    29 NRLKEHMKYN-------ILRNAVFYK----KIPLQKKLKLALERNIGPHAYIIVNDTIYKCQVFV 82

  Fly   145 LQSFSRMFRDMGNDLS----VALPEKMITPRSFGLIYEWMIEDTPVLPRLGLLEVFHAAKFME-I 204
            |:.:.::|.   |:|.    |..|...::...|.|.|.||..:...|||..::.:..|||.:: |
  Fly    83 LRIYCKLFT---NNLKRGDIVKFPRDAMSNECFELAYTWMTNNAIHLPRDKIINLLAAAKCLQCI 144

  Fly   205 PQLVRQCKYCLDH-GFTEDSAAMLYFEAKILKLEVIHLQYLERVSKFFLTLVASKEFLRLPLKSM 268
            |.:.|..::..|: ...|..:...|.:||.:.:..:....:.||:|.||.||::.:|:::.:...
  Fly   145 PLIKRIFEFLNDYRTHCELFSFSCYLKAKDMGMTQVADMMVSRVTKSFLVLVSNGQFIKMDIDGA 209

  Fly   269 LLLIQSDLIGVNTELEVFMAAARWLSHHWPQREENVTDVVSSIRFGLIPPWLLIRLQ------KP 327
            ..|::|..:.|..|:|:|.:|..||..::..|.:.:..|:|.:||.:||...:::..      :|
  Fly   210 CTLLRSRHLAVQNEIEIFYSALLWLISNYEMRIKYIPRVLSLVRFLMIPAVFILQWTSNLKDLRP 274

  Fly   328 DVTSVGVGRIVAQPIVRQAIHEGIAYTTTRMFYGKDREAFKHYLHKACVKP-------------- 378
            ::.:|                                  ..|:||.|.:..              
  Fly   275 ELANV----------------------------------LCHFLHNAMLSQFEYYTETFQSESII 305

  Fly   379 PVQRTWIYDRKCPYHHRMQCRNTVDLTYDAFLEYLNYTQ------------RQHRDYWKSLEPVD 431
            ...|.|..|.:|||..........||:.|.|..||...|            :.|.:|    |..|
  Fly   306 RGNRRWAQDPQCPYLSLFNANGDSDLSPDVFFRYLRQIQNSPKSFVARLIMKDHMEY----EIGD 366

  Fly   432 ASNVCFSCQAKKS--DLTKP 449
            |..|..|..::.|  ||.:|
  Fly   367 ALTVNESWTSENSAEDLKEP 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30357NP_724707.1 BTB 131..217 CDD:197585 24/91 (26%)
BTB <139..211 CDD:295341 21/77 (27%)
BACK 226..323 CDD:285009 27/97 (28%)
DUF4734 337..427 CDD:292506 19/116 (16%)
CG10752NP_648614.1 BACK 172..264 CDD:197943 26/92 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5152287
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22667
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.