DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30357 and CG9970

Sequence 1:NP_724707.1 Gene:CG30357 FlyBaseID:FBgn0050357 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_647754.1 Gene:CG9970 FlyBaseID:FBgn0035380 Length:484 Species:Drosophila melanogaster

Alignment Length:460 Identity:112/461 (24%)
Similarity:186/461 (40%) Gaps:71/461 (15%)


  Fly    21 SSNKVILR---GYASKANKDVEAVEELEEIQEMNDELRDLFINTTAINCSSLSEL------KIQT 76
            ||.|.::|   ......||.:.:..|.:.:|:...|.......:|..:.::..:|      ||..
  Fly    13 SSTKTLVREGESIPQDNNKSISSTIEEDLLQQNKSEKEKTKGTSTDKSTTTDGDLPTVKMDKILQ 77

  Fly    77 DAFNTLKERTLFSLGYSTAGLLK---------------KSK--ISKV--LKGKVNLYQQIVSLVK 122
            .....|..:|.....||.....|               |||  |:::  |..|::..|.:.:::|
  Fly    78 QQRAELLWKTFTDEEYSDWKTFKDSNYKVPLLSVFSYVKSKPFIAEIPNLPPKISGPQLMTNILK 142

  Fly   123 QRTKTNSEITIGKTSHPVHLMVLQSFSRMF--RDMGNDLSVALPEKMITPRSFGLIYEWMIEDTP 185
            ......:.:.||:........:|:.||..|  ||. ........|:.:....|.::||||  .|.
  Fly   143 SNYGALALVQIGENKFKCIPCLLRCFSVWFGIRDW-RITRFKFKEREVPSGGFKVVYEWM--RTN 204

  Fly   186 VLPRLG-LLEVFHAAKFMEIPQLVRQCKYCL-DHGFTEDSAAMLYFEAKIL-KLEVIHLQYLERV 247
            .||... |:.....|..:::..|.::....| |....|..|.::|..|:.: .|..:....|.|:
  Fly   205 KLPEFDELVPALQVACHLKVTLLEKEIWQILSDESVREKVAFLVYLGARRMPALGALCEAMLFRL 269

  Fly   248 SKFFLTLVASKEFLRLPLKSMLLLIQSDLIGVNTELEVFMAAARWLSH-HWPQREENVTDVVSSI 311
            .|:||.||.|..|:||.:..:.:|::.|.||||:|:|||.|..|||.| ...:|.|:...::..:
  Fly   270 RKYFLALVGSPHFVRLKVDVLEMLLRQDSIGVNSEMEVFFAVIRWLGHSRGRKRREHFQRLMKCV 334

  Fly   312 RFGLIPPWLLIRL-------QKPDVTSVGVGRIV--AQPIVRQAIHEGIAYTTTRMFYGKDREAF 367
            ||..:|...|..|       :|.|:.|...|.:.  ..|.:.:.:...|.:.:.|. ...|...|
  Fly   335 RFHHMPMTFLFSLRESFNHPEKFDLFSKEPGMLAFNTDPEMMELLEHAIYFISVRT-QCDDINEF 398

  Fly   368 KHYLHKACVKPPVQRTWIYDRKCPYHHRMQCRNTVDLTYDAFLEYLNYTQRQHR-------DYWK 425
            ........::..:.|.|:|...||:|.|     |:|..|            |||       ||..
  Fly   399 LSTCESHHIEVVLPRWWVYHVNCPFHLR-----TIDFPY------------QHRFTATDFGDYID 446

  Fly   426 SLEPV 430
            |::.|
  Fly   447 SIQKV 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30357NP_724707.1 BTB 131..217 CDD:197585 22/90 (24%)
BTB <139..211 CDD:295341 18/75 (24%)
BACK 226..323 CDD:285009 35/99 (35%)
DUF4734 337..427 CDD:292506 21/99 (21%)
CG9970NP_647754.1 BACK 254..346 CDD:197943 33/92 (36%)
DUF4734 373..450 CDD:292506 21/95 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5152352
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22667
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.