DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30357 and CG12857

Sequence 1:NP_724707.1 Gene:CG30357 FlyBaseID:FBgn0050357 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_610987.1 Gene:CG12857 FlyBaseID:FBgn0033963 Length:440 Species:Drosophila melanogaster

Alignment Length:444 Identity:141/445 (32%)
Similarity:224/445 (50%) Gaps:69/445 (16%)


  Fly    20 VSSNKVI--LRGYASKANKDVEAVEELEEIQEMNDELRDLFINTTAINCSSLSELKIQTDAFNTL 82
            :|||..|  :..:.||| :|:|......:|.:...|      .||::|                 
  Fly    33 LSSNDEINSIARFVSKA-EDLEMHRVFSKISKNGVE------ETTSLN----------------- 73

  Fly    83 KERTLFSLGYS---TAGLLK-----KSKISKVLKGKVNLYQQIVSLVKQRTKTNSEITIGKTSHP 139
              |:||..|::   ..|.||     |.:::.||:          .:.:...||..:|.|......
  Fly    74 --RSLFEFGHNFEDADGWLKLEQPCKDRLATVLR----------YMFESHLKTTVQIEINNMYFN 126

  Fly   140 VHLMVLQSFSRMFRDMGN-DLSVALPEKMITPRSFGLIYEWMIEDTPVLPRLGLLEVFHAAKFME 203
            .|.:|||.:||.|.::.. .|.|.||||:::.::|.|.|:||:.|.|||....::||:.||.::.
  Fly   127 CHFIVLQVYSRFFSELEMIPLLVTLPEKIVSQKAFMLSYKWMLSDEPVLELAHIVEVYVAATYLR 191

  Fly   204 IPQLVRQC-KYCLDHG-FTEDSAAMLYFEAK-ILKLEVIHLQYLERVSKFFLTLVASKEFLRLPL 265
            |..|...| ||..|.. :.||:|.:||.|:| ...::|:....|.|:.||.||.||:::||.||.
  Fly   192 ISGLAAHCWKYFDDEEYYNEDTACVLYVESKDNPAMDVVRNLMLTRIRKFLLTFVATRDFLDLPT 256

  Fly   266 KSMLLLIQSDLIGVNTELEVFMAAARWLSHHWPQREENVTDVVSSIRFGLIPPWLLIRLQKPDVT 330
            ..::.|::||.|.||||:|||..|.|||.|.|.:|:.:|..::|.|||.|:|.|.|:..::.:..
  Fly   257 SHLIFLLESDQICVNTEIEVFFIAVRWLGHDWNKRKVHVRRLMSCIRFNLMPLWYLLYARREEDH 321

  Fly   331 SVGVGRIVAQPIVRQAIHEGIAYTTTRMF----YGKDREAFKHYLHKACVKPPVQRTWIYDRKCP 391
            .: |.:::..|.|...|.|.|:..|:||:    .|.|.::.::      .....||.||.|..|.
  Fly   322 PL-VMKLIFNPEVEYKIDESISRITSRMYEDALEGNDAQSEEY------ASDSGQRNWICDSLCS 379

  Fly   392 YHHRMQCRNTVDLTYDAFLEYLNYTQRQHRDYWKSLEPVDASNVCFSCQAKKSD 445
            |:|.:.|.||.::.:..|.:||:..|:..:|:|        |.|.|...:||.|
  Fly   380 YYHGVGCPNTREIRFKHFEDYLSELQQCSKDHW--------SQVIFQDPSKKID 425

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30357NP_724707.1 BTB 131..217 CDD:197585 34/88 (39%)
BTB <139..211 CDD:295341 28/73 (38%)
BACK 226..323 CDD:285009 44/98 (45%)
DUF4734 337..427 CDD:292506 27/94 (29%)
CG12857NP_610987.1 BTB 104..199 CDD:295341 33/105 (31%)
BACK 215..313 CDD:197943 44/98 (45%)
DUF4734 327..415 CDD:292506 28/102 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5152289
eggNOG 1 0.900 E1_2D27T
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22667
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.