DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30357 and CG12692

Sequence 1:NP_724707.1 Gene:CG30357 FlyBaseID:FBgn0050357 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001284857.1 Gene:CG12692 FlyBaseID:FBgn0029703 Length:553 Species:Drosophila melanogaster

Alignment Length:263 Identity:76/264 (29%)
Similarity:122/264 (46%) Gaps:43/264 (16%)


  Fly   152 FRDMGNDLSVALPEKMITPRSFGLIYEWMIEDTPVLPRL---GLLEVFHAAKFMEIPQLVRQC-- 211
            ||: |.|| :|:        .|...|.||....|:.|.:   .|:.:.|.|..:|:|.|...|  
  Fly    96 FRE-GTDL-IAV--------GFRAAYTWMRLQEPLDPFMQPDKLMTLLHTAVQLEMPALKALCYE 150

  Fly   212 KYCLDHGFTEDSAAMLYFEA-KILKLEVIHLQYLERVSKFFLTLVASKEFLRLPLKSMLLLIQSD 275
            :.|.|. |.|::|..:|..| |..:||.:....|:|:...||.::...:|.|:||:.::.::|.|
  Fly   151 QLCTDR-FREETAFQVYLRALKYPQLEELRKLMLQRIGAAFLAVLGGDDFQRMPLEDVITMLQQD 214

  Fly   276 LIGVNTELEVFMAAARWLSHHWPQREENVTDVVSSIRFGLIPPWLLIRLQK-------PDVTSVG 333
            .:|||:|:||.:|..|||:......::....::..:|..|:|..:|.|..:       ||     
  Fly   215 SLGVNSEMEVLVAIIRWLNCQSKCIDQATPLLMDCLRLTLLPLPILKRFWRCAMAPPVPD----- 274

  Fly   334 VGRIVAQPI---VRQAIH--EGI--AYTTTRMFY-GKDREAFKHYLHKACVKPPVQRTWIYDRKC 390
                  :|.   ||..||  |.|  |.|..:|.: ...|..|..:.....:...:.|.||||.:|
  Fly   275 ------EPFMNAVRGNIHIRERISCAITVVQMHHLHTSRREFLDFCRSKGLLVDMPREWIYDEQC 333

  Fly   391 PYH 393
            .||
  Fly   334 HYH 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30357NP_724707.1 BTB 131..217 CDD:197585 21/70 (30%)
BTB <139..211 CDD:295341 18/62 (29%)
BACK 226..323 CDD:285009 29/98 (30%)
DUF4734 337..427 CDD:292506 20/66 (30%)
CG12692NP_001284857.1 BACK 162..265 CDD:285009 31/103 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5152339
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22667
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.