DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30357 and CG10801

Sequence 1:NP_724707.1 Gene:CG30357 FlyBaseID:FBgn0050357 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_570058.1 Gene:CG10801 FlyBaseID:FBgn0029660 Length:558 Species:Drosophila melanogaster

Alignment Length:483 Identity:113/484 (23%)
Similarity:207/484 (43%) Gaps:96/484 (20%)


  Fly     9 PEGSSCCPID------IVSSNKVILRGYASKAN-----------KDVEAVEELEEIQEMNDELRD 56
            ||.||  ||.      |..|:.:|:...:|...           |.|:|  :..:|.:::.:.|.
  Fly    68 PELSS--PISNTSKLCISESSGLIVASTSSSERITCPPPPLMLPKTVDA--DFADILDISRQRRH 128

  Fly    57 LFINTTAINCSSLSELKIQTD---------AFNTLKERTLFSLGYSTAGLLKKSKISKVLKGKV- 111
            ..|.|:    .|::::.:|.|         |..|.::..:               |.|.:..|: 
  Fly   129 RRICTS----FSINDIPLQIDCPKVDPILRAGGTFRDYEI---------------IWKPMSSKLD 174

  Fly   112 -NLYQQIVSLVKQRTKTNS--------------EITIGKTSHPVHLMVLQSFSRMFRDMGNDLSV 161
             :..:.|:|...:|...|.              ||.|......|..::...|:|.||.:.:.. :
  Fly   175 ESCAENILSRCTRRMNNNEIMWKATKMCWFDDLEIQIESRFFFVSHILFTYFARNFRKISSQF-L 238

  Fly   162 ALPEKMITPRSFGLIYEWMI-EDTPVLPRLGLLEVFHAAKFMEIPQLVRQC--KYCLD--HGFTE 221
            .:|.:.|.......|||||: |:...:....|:..:.||.::.:.||::|.  .:..|  :...|
  Fly   239 QMPVQKIDMAVLIRIYEWMLNEEKTFVVGQNLISFYAAAHWLGVHQLIKQAWSTFSADGVYDIWE 303

  Fly   222 DSAAMLYFEAKILKLEVIHLQYLERVSKFFLTLVASKEFLRLPLKSMLLLIQSDLIGVNTELEVF 286
            .:|...|..||..:...|.:....|:.|.||.:|||.|||...:..:..|::.|::.||:|.|:|
  Fly   304 INAFQAYIMAKDYRCPEIMIVMQSRLRKCFLPIVASWEFLEFDVNEVTTLLEQDMLCVNSEDEIF 368

  Fly   287 MAAARWLSHHWPQREENVTDVVSSIRFGLIPPWLLIRL-------------QKPDVTS-VGVGRI 337
            .|...||::.|.:|:::...|:..:||||:.|||...:             |.|::.| :..|.:
  Fly   369 FAVFHWLNYSWTERKKHAVKVMQKVRFGLLSPWLRRSICNMPENDRIGEIGQLPEICSLIWEGTL 433

  Fly   338 VAQPIVRQAIHEGIAYTTTRMFYGKDREAFKHYLHKACVKPPVQRTWIYDRKCPYHHRMQCRNTV 402
            :.|.|:.....|   |..:|:.    |...:.:.||..    .:|:|::....|:||..:|....
  Fly   434 LCQAIIAIGQPE---YRRSRLV----RRMLRDFEHKRI----TERSWVFCEGVPHHHDKKCARYR 487

  Fly   403 DLTYDAFLEYLNYTQRQHRDYWKSLEPV 430
            :||:::|..:|:........:.:||:.|
  Fly   488 ELTFESFKRFLHRLHTNSDIFMESLKAV 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30357NP_724707.1 BTB 131..217 CDD:197585 22/91 (24%)
BTB <139..211 CDD:295341 19/73 (26%)
BACK 226..323 CDD:285009 34/97 (35%)
DUF4734 337..427 CDD:292506 19/90 (21%)
CG10801NP_570058.1 BACK 306..401 CDD:285009 33/95 (35%)
DUF4734 418..512 CDD:292506 23/105 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5152315
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22667
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.