DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30357 and CG14785

Sequence 1:NP_724707.1 Gene:CG30357 FlyBaseID:FBgn0050357 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_569912.2 Gene:CG14785 FlyBaseID:FBgn0027795 Length:470 Species:Drosophila melanogaster

Alignment Length:387 Identity:98/388 (25%)
Similarity:171/388 (44%) Gaps:71/388 (18%)


  Fly    67 SSLSELKIQTDAFNTLKERTLFSLGYSTAGLLKKSKISKVLKGKVNLYQQIVSLVKQRTKTNSEI 131
            |.|:.|....:.....|:..:..||   :|:...|.|.:|       .:|::.:::::|...:.|
  Fly   113 SLLNHLGDGAEGDGEAKQIVMELLG---SGVQPHSAIERV-------SEQLLHVLREQTLMEAGI 167

  Fly   132 TIGKTSHPVHLMVLQSFSRMFRDMGNDLSVALPEKMITPRSFGLIYEWMIEDTPVLPRLG----- 191
            .:|...:.....|||::::::                ..|.|       |:..|.|.:||     
  Fly   168 FVGNERYRFFKGVLQNYAKIY----------------AARKF-------IDKLPKLDQLGPDAGA 209

  Fly   192 ---LLEVFHAAKFMEIPQLVRQCKYCLD--HGFTEDSAAMLYFE------AKILKLEVIHLQYLE 245
               |.....|.:.::||||:||.:..|.  ..|.||:|...|.|      |:|| .|::    |.
  Fly   210 ERELFARVVAEEVLQIPQLLRQLRSSLSKMEFFNEDTAFKAYLEVRYHPQARIL-CELM----LT 269

  Fly   246 RVSKFFLTLVASKEFLRLPLKSMLLLIQSDLIGVNTELEVFMAAARWLSHHWPQREENVTDVVSS 310
            |:|:.||.:|.|..||......:..::::..:.||:|:|:|::...||.|:|.:|.:....:::.
  Fly   270 RISRVFLCIVGSPFFLYFTEHELTHILRNCYLSVNSEIEIFLSVVLWLEHNWLERGDCAERILAE 334

  Fly   311 IRFGLIPPWLLIRLQKPD--------VTSVGVGRIVAQPIVRQAIHEGIAYTTTRMFYGKDREAF 367
            :.|.|:|.|.|..|.:.:        :.|.||.|::|     ..:.:.|...:...|.|    |.
  Fly   335 VHFALMPTWYLCTLDRSNRCNHFARVIHSPGVQRLIA-----AGLEDAITLKSKPRFSG----AA 390

  Fly   368 KHYLHKACVKPPVQRTWIYDRKCPYHHRMQCRNTVDLTYDAFLEYLNYTQRQHRDYWKSLEP 429
            .|...|...:..:.|.||.|.:|.:||:..|...|..|||||.|||........:.|::..|
  Fly   391 LHRQRKHQEERLLVRDWIVDTECSHHHKSHCEQFVYPTYDAFKEYLARIICCAPNCWRTFRP 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30357NP_724707.1 BTB 131..217 CDD:197585 21/96 (22%)
BTB <139..211 CDD:295341 18/80 (23%)
BACK 226..323 CDD:285009 30/103 (29%)
DUF4734 337..427 CDD:292506 25/90 (28%)
CG14785NP_569912.2 BACK 256..345 CDD:197943 27/94 (29%)
DUF4734 360..450 CDD:292506 29/99 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5152327
eggNOG 1 0.900 E1_2D27T
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22667
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.