DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30357 and klhl41a

Sequence 1:NP_724707.1 Gene:CG30357 FlyBaseID:FBgn0050357 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_001922967.1 Gene:klhl41a ZFINID:ZDB-GENE-081105-22 Length:599 Species:Danio rerio

Alignment Length:386 Identity:69/387 (18%)
Similarity:141/387 (36%) Gaps:60/387 (16%)


  Fly   107 LKGKVNLYQQ------IVSLVKQRTKTNSEITIGKTSHPVHLMVLQSFSRMFRDM-----GNDLS 160
            :|..:.|:|.      :..|:|:....:..:.:|..|.|.|.:::.:.|..||::     |.:..
Zfish     6 VKEDLRLFQSTLLQDGLKELLKENKFVDCILKVGDRSLPCHRLIMAACSPYFRELYFTEDGTEKK 70

  Fly   161 VALPE---KMITPRSFGLIYEWMIEDTPVLPRLGLLEVFHAAKFMEIPQLVRQCKYCLDHGFTED 222
            .|..|   :.:.|....:|..::......:....:.:||..|...:||.:...|...|.:..:..
Zfish    71 DANKEVVLENVDPNIMDMIVNYLYSADIDITDDNVQDVFAVANKFQIPSVFTVCVNYLQNKLSLG 135

  Fly   223 SAAMLYFEAKILKLEVIHLQYLERVSKFFLTLVASKEFLRLPLKSMLLLIQSDLIGVNTELEVFM 287
            :...::....:|....:.:...:.:::.|.||...:|||.........:|..|.:.|..|..||.
Zfish   136 NCLAIFRMGLVLNCPRLAVSARDFIAEHFETLSKDEEFLEFNAPEFFAIIGCDALNVEKEELVFE 200

  Fly   288 AAARWLSHHWPQREENVTDVVSSIRFGLIP-PWLLIRLQKPDVTSVGVGRIVAQPIVRQAIHEGI 351
            ...:|:..:...|.:.:.|....|||.|:| .:|..:::|.|:.......|....:::.|....:
Zfish   201 LLMKWVRKNKENRAKALGDAFEHIRFRLLPEKYLKEKVEKDDIIKADPELIKKLKVIKDAFAGKL 265

  Fly   352 AYTTTRMFYGKDREAFKHYLHKACVKPPVQRTWIYDR----------KCPYH-HRMQC------- 398
            .........|:.......:|:.:      ||..:::|          ...|. :..:|       
Zfish   266 PQIKEGEKEGEGENELPGFLNDS------QRLGMFNRDLILMINDTAAVAYDANENECFLAAMAE 324

  Fly   399 ---RNTVDLT------------------YDAFLEYLNYTQRQHRDYWKSLEPVDASNVCFS 438
               ||.|.:|                  .|:.|:...|....|...|.:|.|:.:....|:
Zfish   325 QIPRNHVSITSKKNLLYVAGGLFVDEENKDSPLQCYFYQMDPHSPNWIALPPMPSPRCLFA 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30357NP_724707.1 BTB 131..217 CDD:197585 19/94 (20%)
BTB <139..211 CDD:295341 15/80 (19%)
BACK 226..323 CDD:285009 22/98 (22%)
DUF4734 337..427 CDD:292506 18/129 (14%)
klhl41aXP_001922967.1 BTB 22..129 CDD:279045 21/107 (20%)
PHA03098 46..521 CDD:222983 61/347 (18%)
BACK 137..239 CDD:285009 22/102 (22%)
KELCH repeat 328..377 CDD:276965 11/49 (22%)
Kelch 339..391 CDD:128874 8/48 (17%)
Kelch_1 380..420 CDD:279660 1/7 (14%)
Kelch_6 431..478 CDD:290672
KELCH repeat 431..474 CDD:276965
Kelch_1 477..520 CDD:279660
KELCH repeat 478..522 CDD:276965
KELCH repeat 525..578 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.