DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-11L and AgaP_AGAP002245

DIOPT Version :9

Sequence 1:NP_001260811.1 Gene:UQCR-11L / 246560 FlyBaseID:FBgn0050354 Length:86 Species:Drosophila melanogaster
Sequence 2:XP_307940.5 Gene:AgaP_AGAP002245 / 1269317 VectorBaseID:AGAP002245 Length:87 Species:Anopheles gambiae


Alignment Length:77 Identity:44/77 - (57%)
Similarity:57/77 - (74%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PVLKADDDEKELVDPQAALREKCQAKGHIASLYNKYQECNDRVNGKSKTTETCMEELFDFVAELD 74
            |.:||.::| ::||||..|||||...|....|:.|||.||:||..:|:|.|||:|||||::.|||
Mosquito    12 PTVKAQEEE-DIVDPQTVLREKCAQHGSAPQLWEKYQACNERVGSRSQTAETCVEELFDYLHELD 75

  Fly    75 HCVAHSLFSKLK 86
            |||..:||||||
Mosquito    76 HCVTKTLFSKLK 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-11LNP_001260811.1 UCR_hinge 23..85 CDD:280480 36/61 (59%)
AgaP_AGAP002245XP_307940.5 UCR_hinge 24..86 CDD:280480 36/61 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 93 1.000 Domainoid score I13967
eggNOG 1 0.900 - - E1_KOG4763
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I7172
OMA 1 1.010 - - QHG52039
OrthoDB 1 1.010 - - D1621720at2759
OrthoFinder 1 1.000 - - FOG0005545
OrthoInspector 1 1.000 - - otm50241
Panther 1 1.100 - - O PTHR15336
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4498
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.