DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-11L and UQCR-11

DIOPT Version :10

Sequence 1:NP_724697.1 Gene:UQCR-11L / 246560 FlyBaseID:FBgn0050354 Length:86 Species:Drosophila melanogaster
Sequence 2:XP_307940.5 Gene:UQCR-11 / 1269317 VectorBaseID:AGAMI1_005558 Length:87 Species:Anopheles gambiae


Alignment Length:77 Identity:44/77 - (57%)
Similarity:57/77 - (74%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PVLKADDDEKELVDPQAALREKCQAKGHIASLYNKYQECNDRVNGKSKTTETCMEELFDFVAELD 74
            |.:||.::| ::||||..|||||...|....|:.|||.||:||..:|:|.|||:|||||::.|||
Mosquito    12 PTVKAQEEE-DIVDPQTVLREKCAQHGSAPQLWEKYQACNERVGSRSQTAETCVEELFDYLHELD 75

  Fly    75 HCVAHSLFSKLK 86
            |||..:||||||
Mosquito    76 HCVTKTLFSKLK 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-11LNP_724697.1 UCR_hinge 23..86 CDD:460531 37/62 (60%)
UQCR-11XP_307940.5 UCR_hinge 24..87 CDD:460531 37/62 (60%)

Return to query results.
Submit another query.