DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and prlh2r

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001108619.1 Gene:prlh2r ZFINID:ZDB-GENE-120411-41 Length:371 Species:Danio rerio

Alignment Length:339 Identity:75/340 (22%)
Similarity:143/340 (42%) Gaps:50/340 (15%)


  Fly    38 FLP----LIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFY---- 94
            |:|    |:.....||..::.:|..|:.|.|.||.:|.|:|:.||:....|..:   ..||    
Zfish    37 FIPLYTMLVLIACSGNLLLLILIGLNKKLHSTTNFLIGNLALVDLVMCLFCVPL---TAFYAFDE 98

  Fly    95 QNYQLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGIL 159
            :.:..|...|.....:....:..|||:|:.::.||...:..|:..|........:||..|:..:.
Zfish    99 RGWVFGQFMCHFVTLMQTATVFAAVLSLTAIAVDRYVVVAYPIRRRGGRWFCGWLVVSIWLCALA 163

  Fly   160 LASPLAFYRSY--------RVRVWKNFTERYCKENTSVLPKYWYVLITILVWLPLGIMLICYIAI 216
            :::|.|.:..|        .:.|.:.|.  :.:|.:.::...:::|::..|  ||..:.|.|.||
Zfish   164 MSTPTALHTVYLDLSETGHEMAVCEEFW--HGQELSRLIYSCFFLLLSYFV--PLAAVSISYCAI 224

  Fly   217 FYKLDRYEKRVLSRENPLTVS-------YKRSVAKTLFIVVVVFAALRLPFTILVVLREKYFGED 274
            ...|   :.|...|....|.|       .:|...:.|.:.|:.||...||..|:.::|:  ...|
Zfish   225 SCHL---QHRATPRLMAATPSNQEKWGRKRRKTFRLLLVSVLSFAFSWLPLQIVNLIRD--LDTD 284

  Fly   275 VSVSSGMQL-FWYISQYLMFLNAA-VNPLIYGFNNENFRRAYYQISWVRRWRDATQMKKFSRSPD 337
            .::.|...: ...:|.:|:.:::| .||.||...::.|      :|::..       ..|.:...
Zfish   285 FAILSKNHVNVIQVSCHLLAMSSACYNPFIYASLHKKF------LSYLCH-------NMFQKRKA 336

  Fly   338 HCCYCAFMKNGKRT 351
            ||...:...:.:.|
Zfish   337 HCTQSSITTSSRMT 350

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 67/292 (23%)
7tm_1 48..303 CDD:278431 65/276 (24%)
prlh2rNP_001108619.1 7tm_1 63..315 CDD:278431 61/264 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.