DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and npy1r

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001095861.1 Gene:npy1r / 793668 ZFINID:ZDB-GENE-080221-1 Length:380 Species:Danio rerio


Alignment Length:287 Identity:73/287 - (25%)
Similarity:135/287 - (47%) Gaps:19/287 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQLGCVGCK 105
            ::..|:.||.:::.|||..|.|.:.||::|||::|:|||...:|.....:..|..::..|.|.||
Zfish    56 VVLLGVIGNLALILVIARQRELHNVTNVLIANLSVSDLLMAVVCLPFTFIYTFMDHWVFGAVMCK 120

  Fly   106 LEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILLASPLAFYRSY 170
            |...:....:..::.:|.:::.:|...|:.|...|.::....:.:..||...:|.|:|...:...
Zfish   121 LNSLVQCCSVSVSIFSLVLIAIERHQLILHPRGWRPSLNHACLGISLTWALAVLTATPFLLFSRV 185

  Fly   171 RVRVWKN----FTERY-----CKE---NTSVLPKYWYVLITILVWLPLGIMLICYIAIFYKLDRY 223
            .....|.    |.|:|     |.|   :..:...|...::.:....||..:.|||:.|:.:|.|.
Zfish   186 TDAPLKQLPSVFQEQYRGKVVCVEEWPSREIKLTYTTGMLVLQYITPLTFIFICYLKIYTRLQRR 250

  Fly   224 E---KRVLSRENPLTVSYKRSVAKTLFIVVVVFAALRLPFTILVVLREKYFGEDVSVSSGMQLFW 285
            .   :|:  |||....|..:.:...||.:||.||...||..:...:.:  :..:|:::....|.:
Zfish   251 NNMMERI--RENKYRSSESKRINIMLFSIVVAFAVCWLPLNVFNAVID--WNHEVAMNCTHNLLF 311

  Fly   286 YISQYLMFLNAAVNPLIYGFNNENFRR 312
            .:.......:..:||:.|||.|.||:|
Zfish   312 SLCHLTAMCSVCINPVFYGFLNRNFQR 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 73/284 (26%)
7tm_1 48..303 CDD:278431 65/269 (24%)
npy1rNP_001095861.1 7tm_1 63..329 CDD:278431 65/269 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.