DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and prlhr2b

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001108618.1 Gene:prlhr2b ZFINID:ZDB-GENE-091117-9 Length:354 Species:Danio rerio

Alignment Length:310 Identity:73/311 (23%)
Similarity:131/311 (42%) Gaps:59/311 (19%)


  Fly    37 TFLPLI--------AFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDF 93
            :|.|||        ..|::||:.::|||...|.:.:.||..|.|:|.:|:|....|....:...|
Zfish    42 SFKPLIIPCYVLVVLVGVFGNYLLIYVICRTRKMHNVTNFFIGNLAFSDMLMCVTCVPFTLAYAF 106

  Fly    94 -YQNYQLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSG 157
             ...:..|...|.|...:..|.:..:|..|:.::.||..|.|.|::.|:::.....|:...|:..
Zfish   107 SAHGWTFGRFMCYLVFLIQPVTVYVSVFTLTAIAVDRYYATVHPLKKRISMAACAYVLSGIWLLS 171

  Fly   158 ILLASPLAFYRSYRVRVWKNFTERYCKENTSVLPKYW---------YVLITILVW--LPLGIMLI 211
            .:|.:| |...:|.|        .:..|..::..::|         |...|:|:.  |||..:.:
Zfish   172 CVLVAP-AVAHTYHV--------EFRDEGLTICEEFWLGQETQRLVYAYSTLLLTYILPLSAVCV 227

  Fly   212 CYIAIFYKL-----------DRYEKRVLSRENPLTVSYKRSVAKTLFIVVVVFAALRLPFTILVV 265
            .|:.|..||           |:.|.:.:.         ||.:.:.:.:||..||...||..:..|
Zfish   228 SYLCISVKLRNCVAPGHRTRDQAEAQRIR---------KRKIFRLVSLVVAAFAVCWLPIHVFNV 283

  Fly   266 LREKYFGEDVSVSSGMQLFWYISQYLMFL----NAAVNPLIYGFNNENFR 311
            ||      |:.:....:..:.:.|.|..|    ::..||.:|.:.::.||
Zfish   284 LR------DIDIRLINKRHFLLIQLLCHLCAMSSSCCNPFLYAWLHDRFR 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 69/296 (23%)
7tm_1 48..303 CDD:278431 65/282 (23%)
prlhr2bNP_001108618.1 7tm_1 62..319 CDD:278431 64/281 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.