DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and npy5r

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001072244.1 Gene:npy5r XenbaseID:XB-GENE-960863 Length:448 Species:Xenopus tropicalis

Alignment Length:450 Identity:82/450 (18%)
Similarity:143/450 (32%) Gaps:174/450 (39%)


  Fly     3 SVSSSDDFDFGKW-DFPAE----RIWLHKPNGEITWKICTFLPLIAFGLYGNFSMVYVIATNRSL 62
            |.|.:.|..|.:| |:.:.    |.:|        ..:.||:.|:  |..||..::..|...|..
 Frog    19 STSETRDSSFPEWEDYNSSVDDIRYFL--------IGLYTFVSLL--GFMGNLLILLAIFKKRKQ 73

  Fly    63 RSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQLGCVGCKLEGFLVVVFLITAVLNLSVVSY 127
            ::..|.:|.|:|.:|:|.:..|....:.......:..|.|.|.:..||..|.::.:.|.|..::.
 Frog    74 KTIINYLIGNLAFSDILVVLFCSPFTLTCVLLDQWIFGEVMCHVVPFLQCVSVLISTLMLMSIAL 138

  Fly   128 DRLTAIVLPMETRLTIRGVQIVVVCTWVSGILLASPLAFYR------------------------ 168
            .|...|..|:.|.||......::...|..|..:.|||..:.                        
 Frog   139 VRYHMIKHPLSTNLTANHGYFLIATVWTLGFTICSPLPVFHKIINLREAFNLDSLINSYLCIESW 203

  Fly   169 ---SYRV---------------------------------------------------------- 172
               |||:                                                          
 Frog   204 PSDSYRIAFTISLLLVQYILPLSCLTISHTSVCRSIGSRLPSRDTKVEENEMINLTLQQPKNHRS 268

  Fly   173 -------RVW-----KNFTERYCKENTSVLPKYWYVLITIL------------------------ 201
                   |.|     :....||.|::.||:|       .||                        
 Frog   269 ELEISSSRRWSYSCVRKHRRRYSKKSASVVP-------AILRRNQESNTGDIPETSMTERSHTLP 326

  Fly   202 --VWLPLGIMLICY-------------IAIFYKLDRYEKRVLSRENPLTVSYKRSVAKTLFIVVV 251
              |:|| |:. ||:             |::...:.|..||            .|.|...|.|:::
 Frog   327 SSVYLP-GVP-ICFEMKPEENSEMHNMISVSKSITRIRKR------------SRRVFCRLTILII 377

  Fly   252 VFAALRLPFTILVVLREKYFGEDVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFR 311
            .||...:|..:..::.:  |..::..:...:|.:.|...|..::..:||::|||.|:..:
 Frog   378 AFAVSWMPLHLFHLVTD--FNANLISNRHFKLVYCICHLLGMVSCCLNPILYGFLNDGIK 435

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 71/404 (18%)
7tm_1 48..303 CDD:278431 66/391 (17%)
npy5rNP_001072244.1 7tmA_NPY5R 43..438 CDD:320520 75/426 (18%)
TM helix 1 44..70 CDD:320520 8/36 (22%)
TM helix 2 77..102 CDD:320520 7/25 (28%)
TM helix 3 115..145 CDD:320520 8/30 (27%)
TM helix 4 156..177 CDD:320520 5/21 (24%)
TM helix 5 209..238 CDD:320520 1/29 (3%)
TM helix 6 363..393 CDD:320520 9/42 (21%)
TM helix 7 406..431 CDD:320520 8/25 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.