DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and npffr1l2

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001165168.1 Gene:npffr1l2 ZFINID:ZDB-GENE-060526-110 Length:484 Species:Danio rerio

Alignment Length:321 Identity:86/322 (27%)
Similarity:146/322 (45%) Gaps:50/322 (16%)


  Fly    38 FLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQLGCV 102
            :|.:....:.||..:..::..||.:|:.|||.|.|:||:|||....|....:|::....:.....
Zfish    59 YLFIFLLCMVGNGLVCLIVLENRRMRTVTNLFILNLAVSDLLVGVFCIPTTLVDNLITGWPFTNT 123

  Fly   103 GCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILLASPLA-- 165
            .||:.|.:..:.:..:|..|..::.||...||.|.:.:||:...::.:|..||..:::..|.|  
Zfish   124 VCKMSGLVQGMSVSASVFTLVAIAVDRFRCIVYPFQPKLTLLVAKVTIVMIWVLAVVIMCPSAVT 188

  Fly   166 -----FYRSYRVRVWKNFTERY----CKE---NTSVLPKYWYVLITILVWLPLGIMLICYIAIFY 218
                 ....|.|| .:::...|    |.|   |..:...|..||...:..:||.::.:.|..|..
Zfish   189 LTVERVEHHYMVR-GEDYNHTYPLFSCFENWANPQMRKVYTTVLFAHIYLIPLTLITLMYGRIGI 252

  Fly   219 KLDRYEKRVLSREN---------------------PLTVSYKRSVAKTLFIVVVVFAALRLPFTI 262
            ||  |...|:|..:                     ||....|..|.|.|.||.::|....||...
Zfish   253 KL--YTTSVISGNDQHDGGQPHTSPQAPGGQQEGRPLISQKKIKVIKMLSIVALLFTISWLPLWT 315

  Fly   263 LVVLREKYFG---EDVSVSSGMQLFWYI---SQYLMFLNAAVNPLIYGFNNENFRRAYYQI 317
            |::|.: |.|   :::.:.||     |:   :.:|.|.|::|||:|||:.||||:|.:..:
Zfish   316 LMLLTD-YGGLNEDELELLSG-----YVFPFAHWLAFSNSSVNPIIYGYYNENFKRGFQAV 370

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 85/312 (27%)
7tm_1 48..303 CDD:278431 78/296 (26%)
npffr1l2NP_001165168.1 7tmA_NPFFR1 53..367 CDD:320647 86/317 (27%)
TM helix 1 54..80 CDD:320647 3/21 (14%)
TM helix 2 87..113 CDD:320647 12/26 (46%)
TM helix 3 125..155 CDD:320647 8/30 (27%)
TM helix 4 166..187 CDD:320647 5/21 (24%)
TM helix 5 224..253 CDD:320647 7/29 (24%)
TM helix 6 290..320 CDD:320647 11/30 (37%)
TM helix 7 335..360 CDD:320647 11/30 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1308959at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.