DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and LOC561565

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_021332202.1 Gene:LOC561565 ID: Length:461 Species:Danio rerio

Alignment Length:335 Identity:91/336 (27%)
Similarity:159/336 (47%) Gaps:57/336 (17%)


  Fly    23 WLHKPNGEITWKICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAM 87
            :||:|.....: |.::|.:....:.||..:.:::..::::|:.|||.|.|:|::|||....|...
Zfish    47 YLHEPFVSAIF-IVSYLLIFIVCMMGNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPT 110

  Fly    88 FMVNDFYQNYQLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVC 152
            .:|::....:..|.:.|||.|.:..:.:..:|..|..::.||...||.|.:.:|||....::::.
Zfish   111 TLVDNIITGWPFGSLVCKLSGMVQGISVSASVFTLVAIAVDRFRCIVYPFKQKLTISTSTLIIII 175

  Fly   153 TWVSGILLASP----LAFYRSYRVRVW---KNFTERY--CKE---NTSVLPKYWYVLITILVWLP 205
            .||..|.:..|    |...:.:||.:.   .|.|:.:  |:|   |..:...|..||...:...|
Zfish   176 IWVLAISIMCPSGVMLQVTKEHRVSILLSDGNTTQPFYWCRENWPNQEMRKIYTTVLFANIYLAP 240

  Fly   206 LGIMLICY----IAIFY--------------------KLDRYEKR-VLSRENPLTVSYKRSVAKT 245
            |.:::|.|    |.:|.                    |..|||.| ::||:       |:.|.|.
Zfish   241 LTLIVIMYARIGITLFKTSMPAPVSQVGTSGSGSGSGKQCRYESRQLVSRK-------KKRVIKM 298

  Fly   246 LFIVVVVFAALRLPFTILVVLREKYFGEDVSVSSGMQ------LFWYISQYLMFLNAAVNPLIYG 304
            |.:|.::|....||...|::|      .|.:..|..|      .|:.::.:|.|.|::|||:|||
Zfish   299 LLVVALLFILSWLPLWALMML------SDYASLSERQHRVINIYFYPLAHWLAFCNSSVNPIIYG 357

  Fly   305 FNNENFRRAY 314
            |.|||||:.:
Zfish   358 FFNENFRKGF 367

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 86/315 (27%)
7tm_1 48..303 CDD:278431 78/298 (26%)
LOC561565XP_021332202.1 7tm_GPCRs 55..367 CDD:333717 88/326 (27%)
TM helix 1 57..81 CDD:320095 4/25 (16%)
TM helix 2 90..112 CDD:320095 9/22 (41%)
TM helix 3 128..150 CDD:320095 5/22 (23%)
TM helix 4 171..187 CDD:320095 4/16 (25%)
TM helix 5 226..249 CDD:320095 7/23 (30%)
TM helix 6 293..318 CDD:320095 8/25 (32%)
TM helix 7 335..360 CDD:320095 11/25 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1308959at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.