DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and NPY5R

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_011530317.1 Gene:NPY5R HGNCID:7958 Length:452 Species:Homo sapiens

Alignment Length:390 Identity:73/391 (19%)
Similarity:135/391 (35%) Gaps:120/391 (31%)


  Fly    37 TFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQLGC 101
            ||:.|:  |..||..::..:...|:.::..|.:|.|:|.:|:|.:..|....:.:.....:..|.
Human    56 TFVSLL--GFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGK 118

  Fly   102 VGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILLASPLAF 166
            |.|.:..||..|.::.:.|.|..::..|...|..|:...||......::...|..|..:.|||..
Human   119 VMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPV 183

  Fly   167 YRSYRVRVWKNF-----TERY-CKE---NTSVLPKYWYVLITILVWLPLGIMLICYIAIFYKLD- 221
            :.|. |.:.:.|     :.|| |.|   :.|....:...|:.:...|||..:.:.:.::...:. 
Human   184 FHSL-VELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISC 247

  Fly   222 -----------------------------------------------RYEKRVL---------SR 230
                                                           ||.|:..         |:
Human   248 GLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQ 312

  Fly   231 EN--------------PLTVSYK-----------------------------------RSVAKTL 246
            ||              .|:.|.|                                   |||...|
Human   313 ENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRL 377

  Fly   247 FIVVVVFAALRLPFTILVVLREKYFGEDVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFR 311
            .|:::|||...:|..:..|:.:  |.:::..:...:|.:.|...|..::..:||::|||.|...:
Human   378 TILILVFAVSWMPLHLFHVVTD--FNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIK 440

  Fly   312  311
            Human   441  440

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 70/384 (18%)
7tm_1 48..303 CDD:278431 65/370 (18%)
NPY5RXP_011530317.1 7tm_4 56..>178 CDD:304433 29/124 (23%)
7tm_1 65..432 CDD:278431 65/370 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.