DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and sNPF-R

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001262086.1 Gene:sNPF-R FlyBaseID:FBgn0036934 Length:600 Species:Drosophila melanogaster

Alignment Length:385 Identity:80/386 (21%)
Similarity:146/386 (38%) Gaps:87/386 (23%)


  Fly     1 MASVSSSDDFDFGKWDFPAERIWLHKPNGEITWKICTFLPLIAFGLYGNFSMVYVIATNRSLRSP 65
            :|.|::||:...|.        .:|....:|.:.: .:..:...|::||..:.||:..||::::.
  Fly    42 LADVAASDEDRSGG--------IIHNQFVQIFFYV-LYATVFVLGVFGNVLVCYVVLRNRAMQTV 97

  Fly    66 TNLIIANMAVADLLTLAICPAMFMVNDFYQNYQLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRL 130
            ||:.|.|:|::|:|...:......:..|...:..|...|.|..|.....:..:.|.|:.::.||.
  Fly    98 TNIFITNLALSDILLCVLAVPFTPLYTFMGRWAFGRSLCHLVSFAQGCSIYISTLTLTSIAIDRY 162

  Fly   131 TAIVLPMETRLTIRGVQIVVVCTWVSGILLASPLAFYRSYR------------------------ 171
            ..|:.|...|:.:.....::|..||..:|...|...|....                        
  Fly   163 FVIIYPFHPRMKLSTCIGIIVSIWVIALLATVPYGMYMKMTNELVNGTQTGNETLVEATLMLNGS 227

  Fly   172 -VRVWKNFTER----------------------------YCKENTSVLPKYWY------VLITIL 201
             |.....|.|.                            ||:||   .|...|      :..|:.
  Fly   228 FVAQGSGFIEAPDSTSATQAYMQVMTAGSTGPEMPYVRVYCEEN---WPSEQYRKVFGAITTTLQ 289

  Fly   202 VWLPLGIMLICYIAIFYKLDRYEKRVLSRENPLTVSYKRSVA---------KTLFIVVVVFAALR 257
            ..||..|:.|||:.|..||::     .:|..|.:.|.:|..|         :.|..:|.||....
  Fly   290 FVLPFFIISICYVWISVKLNQ-----RARAKPGSKSSRREEADRDRKKRTNRMLIAMVAVFGLSW 349

  Fly   258 LPFTILVVLREKYFGEDVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFRRAYYQI 317
            ||..::.:..:  |.:..:......||::::..:...:...||.:|.:.|||||:.:..:
  Fly   350 LPINVVNIFDD--FDDKSNEWRFYILFFFVAHSIAMSSTCYNPFLYAWLNENFRKEFKHV 407

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 73/339 (22%)
7tm_1 48..303 CDD:278431 66/323 (20%)
sNPF-RNP_001262086.1 7tm_4 75..>196 CDD:304433 31/121 (26%)
7tm_1 80..393 CDD:278431 66/323 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24235
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.