DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and npy4r

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_571515.1 Gene:npy4r ZFINID:ZDB-GENE-980526-393 Length:377 Species:Danio rerio

Alignment Length:306 Identity:79/307 (26%)
Similarity:139/307 (45%) Gaps:37/307 (12%)


  Fly    31 ITWKICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQ 95
            :|..:|..|.|| .||.||..::.:|...|...:.|:::|||::|:|:|....|....:|.....
Zfish    43 LTLVLCYCLVLI-LGLLGNILLICIIMHQRDPPNVTSILIANLSVSDILVSVFCLPFTVVYTLMD 106

  Fly    96 NYQLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILL 160
            ::..|.:.|:|..|:..|.:..:||:|.:::.:|...|:.|...:.::....|.|:..|:...:.
Zfish   107 HWIFGALLCRLMPFVQCVSVTVSVLSLVLIALERHQLILHPSGWKPSVPQAYIAVLTVWLLACVT 171

  Fly   161 ASP-LAFY----RSYR------------VRVWKNFTERYCKENTSVLPKYWYVLITILVWLPLGI 208
            :.| |||:    ..|.            :.||.:...:.....:.:|.:|         ..||.:
Zfish   172 SLPFLAFHLLTSEPYSLFPAPLSQLQVCLEVWPSQDHKLAYTTSLLLFQY---------CCPLLL 227

  Fly   209 MLICYIAIFYKLDRYEKRVLSR-------ENPLTVSYKRSVAKTLFIVVVVFAALRLPFTILVVL 266
            ||:||:.||.:|.|.| |:|.|       :....|.:.:.:...|..:|..||...||.....|:
Zfish   228 MLLCYLRIFLRLQRRE-RMLERQCSRNREDEHRRVMHSKRINVMLATLVAAFAVCWLPLNAFNVV 291

  Fly   267 REKYFGEDVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFRR 312
            .:  ..::|.......|.:.:...|...:..|||:||||.|.|||:
Zfish   292 AD--CDQEVLPVCNHNLLFSLCHLLAMSSTCVNPIIYGFLNSNFRK 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 74/294 (25%)
7tm_1 48..303 CDD:278431 65/279 (23%)
npy4rNP_571515.1 7tm_1 65..326 CDD:278431 63/273 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.