DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and npy8ar

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_571512.1 Gene:npy8ar ZFINID:ZDB-GENE-990415-175 Length:373 Species:Danio rerio

Alignment Length:362 Identity:81/363 (22%)
Similarity:150/363 (41%) Gaps:70/363 (19%)


  Fly    32 TWKICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQN 96
            |..|..:..:||.||.||..:|::|:..:.:|:.||::|||::.:|:|...:|..:.::......
Zfish    31 TLLIVAYSTVIAVGLVGNTCLVFIISRQKEMRNVTNILIANLSCSDILMCVVCLPVTVIYTLMDR 95

  Fly    97 YQLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILLA 161
            :.||...||:..|:..:.:..::.:|.:::.:|...|:.|...........:.|..||:....::
Zfish    96 WILGETLCKVTPFVQCMSVTVSIFSLVLIALERHQLIIHPTGWTPAAGHSYLAVAVTWMVACFIS 160

  Fly   162 SPLAFYRSYRVRVWKNFTERY--------CKENTSVLPK------YWYVLITILVWLPLGIMLIC 212
            .|...:.......::|.:..:        |.|   :.|.      |...|:.....|||.::|:|
Zfish   161 LPFLSFNILTNAPFQNISLPFNPFSDHVICME---LWPSERNRLAYTTSLLLFQYCLPLLLILLC 222

  Fly   213 YIAIFYKL----DRYEKRVLSRENPLTVSYKRSVAKTLFIVVVVFAALRLPFTILVVLREKYF-- 271
            |:.||.:|    |..|:...:|:.....:.:  |...|.::||.||...||..:...:.:.|.  
Zfish   223 YLRIFLRLRRRKDMVEQATEARQRKARGAQR--VNAMLVVIVVAFALCWLPLNVFNTIFDWYHQA 285

  Fly   272 ----GEDVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFRRAY------------------ 314
                ..||..|:        .......:..|||::|||.|.||::..                  
Zfish   286 LPACQHDVIFSA--------CHLTAMASTCVNPVVYGFLNTNFQKELKATLQRCNCGWGVPETYE 342

  Fly   315 -YQISWVRRWRDATQMKKFS--------RSPDHCCYC 342
             :.:|.|     ||.:.|.|        || :.|.:|
Zfish   343 SFPLSTV-----ATDVSKVSSMQHGSLIRS-EQCAHC 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 67/314 (21%)
7tm_1 48..303 CDD:278431 59/279 (21%)
npy8arNP_571512.1 7tm_4 43..>128 CDD:304433 21/85 (25%)
7tm_1 47..313 CDD:278431 59/279 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.