DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and Npy1r

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001106828.1 Gene:Npy1r RGDID:3198 Length:382 Species:Rattus norvegicus

Alignment Length:298 Identity:72/299 (24%)
Similarity:135/299 (45%) Gaps:12/299 (4%)


  Fly    25 HKPNGEITWKICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFM 89
            |.|...|......:..:|..|:.||.:::.:|...:.:|:.||::|.|::.:|||...:|.....
  Rat    33 HLPLAVIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAVMCLPFTF 97

  Fly    90 VNDFYQNYQLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTW 154
            |.....::..|...|||..|:..|.:..::.:|.:::.:|...|:.|...|...|...|.:...|
  Rat    98 VYTLMDHWVFGETMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYIGITVIW 162

  Fly   155 VSGILLASPLAFYRSYRVRVWKN-----FTERY-CKE---NTSVLPKYWYVLITILVWLPLGIML 210
            |..:..:.|...|:......::|     |.::| |.:   :.|....|..:|:.:..:.||..:.
  Rat   163 VLAVASSLPFVIYQILTDEPFQNVSLAAFKDKYVCFDKFPSDSHRLSYTTLLLVLQYFGPLCFIF 227

  Fly   211 ICYIAIFYKLDRYEKRV-LSRENPLTVSYKRSVAKTLFIVVVVFAALRLPFTILVVLREKYFGED 274
            |||..|:.:|.|....: ..|::....|..:.:...|..:||.||...||.||...:.:  :...
  Rat   228 ICYFKIYVRLKRRNNMMDKIRDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFD--WNHQ 290

  Fly   275 VSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFRR 312
            :..:....|.:.:......::..|||:.|||.|:||:|
  Rat   291 IIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 68/280 (24%)
7tm_1 48..303 CDD:278431 60/265 (23%)
Npy1rNP_001106828.1 7tm_4 51..>178 CDD:304433 31/127 (24%)
7tm_1 56..319 CDD:278431 60/265 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24235
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.