DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and PRLHR

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_004239.2 Gene:PRLHR HGNCID:4464 Length:370 Species:Homo sapiens

Alignment Length:332 Identity:88/333 (26%)
Similarity:148/333 (44%) Gaps:64/333 (19%)


  Fly    24 LHKPNGEITWKICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMF 88
            :|:..|.|   :..:..::..||.||..:|.|||..|.|.:.||.:|.|:|::|:|....|..:.
Human    56 VHQLKGLI---VLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLT 117

  Fly    89 MVNDFY-QNYQLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVC 152
            :...|. :.:..|...|.|..||..|.:..:|..|:.::.||...:|.|:..|:::|.....|:.
Human   118 LAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLA 182

  Fly   153 TWVSGILLASPLAFYRSYRVRVWKNFTERYCKENTSVLPKYW-------------YVLITILVWL 204
            .|....:||.|.|.: :|.|.: |....|.|:|       :|             .:|:|.|  |
Human   183 IWALSAVLALPAAVH-TYHVEL-KPHDVRLCEE-------FWGSQERQRQLYAWGLLLVTYL--L 236

  Fly   205 PLGIMLICYIAIFYKLDRYEKRVLSRENPLTVSY---------KRSVAKTLFIVVVVFAALRLPF 260
            ||.::|:.|:.:..||   ..||:    |..|:.         :|.....|.::|||||...||.
Human   237 PLLVILLSYVRVSVKL---RNRVV----PGCVTQSQADWDRARRRRTFCLLVVIVVVFAVCWLPL 294

  Fly   261 TILVVLR-------EKY-FGEDVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFRRAYYQ- 316
            .:..:||       :.| ||          |...:..:|...:|..||.||.:.:::||....: 
Human   295 HVFNLLRDLDPHAIDPYAFG----------LVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKL 349

  Fly   317 -ISWVRR 322
             ::|.|:
Human   350 LVAWPRK 356

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 83/302 (27%)
7tm_1 48..303 CDD:278431 78/286 (27%)
PRLHRNP_004239.2 7tmA_PrRP_R 77..346 CDD:320516 81/297 (27%)
TM helix 2 95..120 CDD:320516 8/25 (32%)
TM helix 3 134..164 CDD:320516 9/30 (30%)
TM helix 4 175..196 CDD:320516 6/21 (29%)
TM helix 5 222..251 CDD:320516 8/31 (26%)
TM helix 6 271..301 CDD:320516 10/30 (33%)
TM helix 7 314..339 CDD:320516 8/35 (23%)
Required for interaction with GRIP1, GRIP2 and PICK1. {ECO:0000269|PubMed:11641419} 365..370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.