DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and GPR3

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_005272.1 Gene:GPR3 HGNCID:4484 Length:330 Species:Homo sapiens

Alignment Length:317 Identity:73/318 (23%)
Similarity:132/318 (42%) Gaps:74/318 (23%)


  Fly    49 NFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQLGCVGCK-----LEG 108
            |..:|.:|....:.|:|..|::.::||||||.     .:.:|..|...:   |:|..     |.|
Human    58 NALVVAIIVGTPAFRAPMFLLVGSLAVADLLA-----GLGLVLHFAAVF---CIGSAEMSLVLVG 114

  Fly   109 FLVVVFLITAVLNLSVVSYDR----LTAIVLPMETRLTIRGVQIVVVCTWVSGILLASPLAFYRS 169
            .|.:.| ..::.:|..::.||    ..|:....||.:|...|.:.:|.....|:.|...||    
Human   115 VLAMAF-TASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLA---- 174

  Fly   170 YRVRVWKNFTERYCKENTSV------LPKYWYVLITILVWLPLGIMLICYIAIFYKLDRYEKRVL 228
                 |.      |.:..:.      |.|...|::.|..::..||||..|..|...:.|:.:::.
Human   175 -----WN------CLDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIA 228

  Fly   229 SRENPLTVSY----KRSVAKTLFIVVVVFAALRLPFTILVVLREKYFGEDVSVSSGMQLFWYISQ 289
            .:.:.|..|:    ::.:| ||.:|:..|||..||||:..:|.:.:         ...|:.|::.
Human   229 LQRHLLPASHYVATRKGIA-TLAVVLGAFAACWLPFTVYCLLGDAH---------SPPLYTYLTL 283

  Fly   290 YLMFLNAAVNPLIYGFNNENFRRAYYQISWVRRWRDATQMKKFSRSPDHCCYCAFMK 346
            .....|:.:||:||.|.|::.::..:.:                     ||.|:..|
Human   284 LPATYNSMINPIIYAFRNQDVQKVLWAV---------------------CCCCSSSK 319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 69/285 (24%)
7tm_1 48..303 CDD:278431 66/273 (24%)
GPR3NP_005272.1 7tm_GPCRs 41..308 CDD:333717 69/284 (24%)
TM helix 1 43..67 CDD:320095 3/9 (33%)
TM helix 2 76..97 CDD:320095 8/26 (31%)
TM helix 3 110..132 CDD:320095 5/23 (22%)
TM helix 4 155..171 CDD:320095 4/16 (25%)
TM helix 5 191..214 CDD:320095 8/23 (35%)
TM helix 6 243..268 CDD:320095 11/26 (42%)
TM helix 7 276..301 CDD:320095 8/25 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S7241
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.