DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and npr-5

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001024265.1 Gene:npr-5 WormBaseID:WBGene00021983 Length:433 Species:Caenorhabditis elegans

Alignment Length:330 Identity:68/331 (21%)
Similarity:139/331 (42%) Gaps:49/331 (15%)


  Fly    35 ICTFLP--LIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLL----TLAICPAMFMVNDF 93
            |.|||.  |...|::||..:::.:|.|:.|:|..|:.:.|:...||:    .:.:.|...|..| 
 Worm    57 IFTFLYGFLFVLGIFGNGGVLWAVARNKRLQSARNVFLLNLIFTDLILVFTAIPVTPWYAMTKD- 120

  Fly    94 YQNYQLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGI 158
               :..|.|.|.|........:.....:|:.:|.|:...|..|.:..::||....:....|:...
 Worm   121 ---WAFGSVMCHLVPLSNSCSVFVTSWSLTAISLDKFLHINDPTKQPVSIRQALAITFLIWIVST 182

  Fly   159 LLASP--LAFYR---SYRVRVWKN-FTERYC------KENTSVLPKYWYVLITILVWLPLGIMLI 211
            |:..|  ::|..   |:.|:..:. :...:|      .||:..:  |...::.:...:|:.::..
 Worm   183 LINLPYLMSFEHVDGSFYVQPGETPYCGHFCDEANWQSENSRKI--YGTTVMLLQFVVPMAVITY 245

  Fly   212 CYIAIFYKLDR--------YEKRVLSRENPLTVSYKRSVAKTLFIVVVVFAALRLPFTILVVLRE 268
            ||..|..|:.:        :.:.:..::.....|.|:.|...|..:||.|....||.|:|.::::
 Worm   246 CYFKILQKVSKDMIIQNAQFCQSLTQKQRSDATSRKKKVNYILIAMVVTFIGCWLPLTLLNLVKD 310

  Fly   269 KYFGEDVSVSSGMQLFWYISQYLMFLNAAV-NPLIYGFNNENFRRAYYQISWVRRWRDATQMKKF 332
              |.::.........||.|:.:::.::..| |||::              .|:.|.:..:.:.|.
 Worm   311 --FKKEPEWLKRQPFFWAINAHVIAMSLVVWNPLLF--------------FWLTRKQKRSGLSKI 359

  Fly   333 SRSPD 337
            ..|.:
 Worm   360 LNSTE 364

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 59/296 (20%)
7tm_1 48..303 CDD:278431 58/280 (21%)
npr-5NP_001024265.1 7tm_1 72..343 CDD:278431 58/279 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.