DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and npr-6

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_509725.2 Gene:npr-6 WormBaseID:WBGene00009619 Length:402 Species:Caenorhabditis elegans

Alignment Length:333 Identity:84/334 (25%)
Similarity:149/334 (45%) Gaps:64/334 (19%)


  Fly    48 GNFSMVYVIATNRSLRSPTNLIIANMAVADLL----TLAICPAMFMVNDFYQNYQLGCVGCKL-E 107
            |||.:|||:.||:.:::.||:.|.|:||:|::    :|.:.|....:..:.....| |.|..| :
 Worm    54 GNFLVVYVVMTNKRMQTITNIFITNLAVSDIMVNFTSLWLTPTYTSIGHWIFGGGL-CHGLPLFQ 117

  Fly   108 GFLVVVFLITAVLNLSVVSYDRLTAIV-----LPMETRLTIRGVQIVVVCTWVSGILLASPLAFY 167
            |  ..:|:.|  ..|:.::.||...||     :.:..|:::|.....:|..|:..:||.:|    
 Worm   118 G--TSIFIST--WTLTAIAIDRYIVIVHNSSNININDRMSMRSCLSFIVLIWLCSLLLVTP---- 174

  Fly   168 RSYRVRVWKNFTERYCK--------ENTSVLPKYWYVLITILVWLPLGIMLICYIAIFYKLDRYE 224
              |.:.:..|:....|.        .|......:..|::.:...||..::.|.||.|:..|:   
 Worm   175 --YAINMKLNYIHEPCDFLICSEDWSNAEFRSIFGIVVMILQFILPFVLIAISYIKIWLFLN--- 234

  Fly   225 KRVLSRENPLTVSYKRSVAKTLFIVVVVFAALRLPFTILVVLREKYFGEDVSVSSGMQ---LFWY 286
            .|....|....:..|:.:.:.|.::||:||....||.:|..||      |:.:.:.|:   .|.:
 Worm   235 SRQSMTERKSDIKRKKRLLRMLIVMVVIFAICWFPFNLLNCLR------DLKLDNFMRGYFSFVF 293

  Fly   287 ISQYLMFLNA-AVNPLIYGFNNENFRRAYYQI---SWVRR-------------------WRDATQ 328
            :|.:||.:.| |.||::|.|.||.||..:.::   .:.||                   :|.|.:
 Worm   294 LSVHLMSMTATAWNPILYAFMNETFREEFAKVVPCLFARRPGTGPIRVITERTAMITNPFRRANR 358

  Fly   329 MKKFSRSP 336
            .||....|
 Worm   359 KKKVEEQP 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 77/289 (27%)
7tm_1 48..303 CDD:278431 71/277 (26%)
npr-6NP_509725.2 7tm_4 44..>229 CDD:304433 46/186 (25%)
7tm_1 54..311 CDD:278431 71/277 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.