DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and npr-8

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_741834.1 Gene:npr-8 WormBaseID:WBGene00016984 Length:510 Species:Caenorhabditis elegans

Alignment Length:516 Identity:104/517 (20%)
Similarity:184/517 (36%) Gaps:185/517 (36%)


  Fly    17 FPAERIWLHK-------------PNGEITWKICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNL 68
            :|.:.:.|.|             |..||.:.....:..:| .:.||..::..:...:::|:..|:
 Worm    44 YPFDGLCLQKFFYQLQTSLRRFTPYEEIIYTTVYIIISVA-AVIGNGLVIMAVVRKKTMRTNRNV 107

  Fly    69 IIANMAVADLLTLAI--CPAMFMVN-DF---YQNYQLGCVGCKLEGFLVVVFLITAVLNLSVVSY 127
            :|.|:|:::|: |||  .|.:::.: ||   |..:     .||....|....:..:.|.:||::.
 Worm   108 LILNLALSNLI-LAITNIPFLWLPSIDFEFPYSRF-----FCKFANVLPGSNIYCSTLTISVMAI 166

  Fly   128 DRLTAIVLPMETRLTIRG-------VQIVVVCTWVSGILLASPLAFY---------RSYRV---- 172
            ||..::     .:|.|..       ..:|.:..|:...:|:.||..|         |..||    
 Worm   167 DRYYSV-----KKLKIASNRKQCFHAVLVSLAIWIVSFILSLPLLLYYETSMLYVMREIRVVDQS 226

  Fly   173 --RVWKNFTERYCK-ENTSVLPKYWYVLITILVWLPLGIMLICY--------IAIF-YKLDRYEK 225
              .|.:::..|.|: .:...||.     ||..:.|.:.|:.:.:        ::|| .||.|:.|
 Worm   227 GQEVIRSYGWRQCRLVSAGRLPD-----ITQSIQLLMSILQVAFLYIVPLFVLSIFNVKLTRFLK 286

  Fly   226 -------------------------------RVLSRENPLTVSYKRSVA----------KTLFIV 249
                                           ...|..:|...|.:.|:.          :|..::
 Worm   287 TNANKMSKTRAPPKRFDRSDSHHNSLKNNNNHTSSLRSPSMPSIRSSITERNKTNQRTNRTTSLL 351

  Fly   250 VVV---FAALRLPFTILVVL--REKYFGEDVSVSSGMQLFWYISQ---YLMFLNAAVNPLIYGFN 306
            :.:   :|||..|||::..|  .|....:|.     :.|...|.|   .:..|:..|||.:|||.
 Worm   352 IAMAGSYAALWFPFTLITFLIDFELIINQDY-----VNLVERIDQTCKMVSMLSICVNPFLYGFL 411

  Fly   307 NENFRRAYYQISWVRRWRDATQMKKFSRSPDHCCYCAFMKNGKRTSEAAQKAGNLEKDIS----- 366
            |.|||..:..|                       |..::    |....:|.||....|:|     
 Worm   412 NTNFRHEFSDI-----------------------YYRYI----RCETKSQPAGRFHHDVSSIAHH 449

  Fly   367 ---------------------KDMSSAQQSAKS--------TKIVENEFV--SEIEADGFI 396
                                 ||.||:....:|        ||::.:..|  .:||.|.|:
 Worm   450 RQDSVYNDEATLLTTGRQSNGKDGSSSPIGFRSSVRVCSGQTKMIGDRIVLDDDIEKDSFV 510

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 77/358 (22%)
7tm_1 48..303 CDD:278431 70/342 (20%)
npr-8NP_741834.1 7tm_4 85..>215 CDD:304433 31/141 (22%)
7tm_1 87..408 CDD:278431 70/342 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130740081
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.