DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and Npy2r

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_032757.2 Gene:Npy2r MGIID:108418 Length:381 Species:Mus musculus

Alignment Length:310 Identity:94/311 (30%)
Similarity:147/311 (47%) Gaps:57/311 (18%)


  Fly    35 ICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQL 99
            |..:..:|..|:.||..:::|:...:|:|:.||..|||:||||||...:|....:.......:::
Mouse    54 ILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKM 118

  Fly   100 GCVGCKL----EGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILL 160
            |.|.|.|    :|..|.|..||    |:|::.||...||..:|::::.|...:::...|....||
Mouse   119 GPVLCHLVPYAQGLAVQVSTIT----LTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALL 179

  Fly   161 ASPLAFYRSYR-VRVWKNF-----TERYCKENTSVLPKYWYVLITILVW--LPLGIMLICYIAIF 217
            |||||.:|.|. :.:..:|     ||::..|..||.... |.|.|:|:.  |||||:...|..|:
Mouse   180 ASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTV-YSLSTLLILYVLPLGIISFSYTRIW 243

  Fly   218 YKL----------DRYEKRVLSRENPLTVSYKRSVAKTLFIVVVVFAALRLP---FTILV----- 264
            .||          |.|.:|            :..:.|.|..||||||...||   |.:.|     
Mouse   244 SKLRNHVSPGAASDHYHQR------------RHKMTKMLVCVVVVFAVSWLPLHAFQLAVDIDSH 296

  Fly   265 VLREKYFGEDVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFRRAY 314
            ||..|.:          :|.:.:...:...:...|||:||:.|.|:|:|:
Mouse   297 VLDLKEY----------KLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAF 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 92/302 (30%)
7tm_1 48..303 CDD:278431 85/285 (30%)
Npy2rNP_032757.2 7tm_4 60..>265 CDD:304433 68/222 (31%)
7tm_1 67..325 CDD:278431 85/285 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.