DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and npr-1

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_508816.1 Gene:npr-1 WormBaseID:WBGene00003807 Length:457 Species:Caenorhabditis elegans

Alignment Length:353 Identity:78/354 (22%)
Similarity:147/354 (42%) Gaps:81/354 (23%)


  Fly    30 EITWKI---------------CTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVAD-- 77
            ::.||:               ..:|.|...||:||.:::||..::::|.|..|:.|.|:|.:|  
 Worm    10 QVYWKVYPDPSQSIYAIVPFLTVYLFLFFLGLFGNVTLIYVTCSHKALLSVQNIFILNLAASDCM 74

  Fly    78 --LLTLAICPAMFMVNDFYQNYQLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETR 140
              :|:|.|.|    :.:.|:|:..|.:.|.|...:..:.:.....:|..::.||...:|.|..|.
 Worm    75 MCILSLPITP----ITNVYKNWYFGNLLCHLIPCIQGISIFVCTFSLGAIALDRYILVVRPHSTP 135

  Fly   141 LTIRGVQIVVVCTWVSGILLASPLAFYRSYRVRVWKNFTER----YCKEN-TSVLPKYWYVLITI 200
            |:.||..:..|..|:...::..|.||    .:::.:...||    :|.|. .|...:..|.:|.:
 Worm   136 LSQRGAFLTTVLLWILSFVVTLPYAF----NMQMIEYTEERICGYFCTEKWESAKSRRAYTMIVM 196

  Fly   201 LVW--LPLGIMLICY---IAIFYK--------------------------LDRYEKRV------L 228
            |..  :|..:|..||   :::..|                          |::||..:      .
 Worm   197 LAQFVVPFAVMAFCYANIVSVLSKRAQTKIRKMVERTSALESSCAFPSHGLEQYENELNEFLDKQ 261

  Fly   229 SRENPLTVSYKRSVAKTLFIVVVVFAALRLPFTILVVLRE--------KYFG-EDVSVSSGMQLF 284
            .:|....|...|.....|..:||.|....||..::.::.|        :.:| :|..:|..:.||
 Worm   262 EKEKQRVVLQNRRTTSILVTMVVWFGITWLPHNVISLIIEYDDTQSFFRLYGRDDYDISYLLNLF 326

  Fly   285 WYISQYLMFLNAAVNPLIYGFNNENFRR 312
               :..:...|..:||::|.:.|.:||:
 Worm   327 ---THSIAMSNNVLNPVLYAWLNPSFRQ 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 74/325 (23%)
7tm_1 48..303 CDD:278431 68/310 (22%)
npr-1NP_508816.1 7tm_1 44..342 CDD:278431 67/309 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.