DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and npffr2

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_002940397.1 Gene:npffr2 XenbaseID:XB-GENE-994428 Length:426 Species:Xenopus tropicalis

Alignment Length:372 Identity:96/373 (26%)
Similarity:181/373 (49%) Gaps:23/373 (6%)


  Fly    23 WLHKPNGEITWKICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAM 87
            :||:|:....: |.::|.:....:.||..:.:::.:::.:|:.|||.|.|:|::|||....|...
 Frog    36 YLHRPSVAAVF-IASYLLIFILCMLGNGVVCFIVLSSKHMRTVTNLFILNLAISDLLVGIFCMPT 99

  Fly    88 FMVNDFYQNYQLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVC 152
            .::::....:..|...||:.|.:..:.:..:|..|..::.||...||.|.:.:|||....:::|.
 Frog   100 TLLDNIIAGWPFGSTVCKMSGMVQGISVSASVFTLVAIAVDRFRCIVYPFKQKLTISTAVVIIVV 164

  Fly   153 TWVSGILLASPLAFY------RSYRVRVW-KNFTE--RYCKE---NTSVLPKYWYVLITILVWLP 205
            .||..|.:..|.|..      :::||.:. .|.|.  .:|:|   |..:...|..||.:.:...|
 Frog   165 IWVLAIAIMCPSAVMSHVKEDKNFRVVIGNSNQTNPIYWCREDWPNPEMRKIYTTVLFSNIYLAP 229

  Fly   206 LGIMLICYIAIFYKLDRYEKRVLSRENPL---TVS-YKRSVAKTLFIVVVVFAALRLPFTILVVL 266
            |.:::|.|..|...|.:.|..|.::.:..   .|| .|:.|.|.|.|:.::|....||...|::|
 Frog   230 LSLIVIMYARIGITLFKSELNVENKNHQQPRHAVSRRKQKVIKMLIIIALLFILSWLPLWTLMML 294

  Fly   267 REKYFGEDVSVSSGMQLFWY-ISQYLMFLNAAVNPLIYGFNNENFRRAYYQISWVRRWRDATQMK 330
            .: |.....:....:.::.| .:.:|.|.|:::||:||||.||||||.:.....::...:..:.:
 Frog   295 TD-YANLTQNQYQMINIYIYPFAHWLAFFNSSINPIIYGFFNENFRRGFQAAFKLQLCSEELERR 358

  Fly   331 KF--SRSPDHCCYCAFMKNGKRTSEAAQK--AGNLEKDISKDMSSAQ 373
            ..  .|:..:....|...|..|.:.|.:|  :.:.|.|..|.::|.|
 Frog   359 TMYSHRAQGNAILPAASHNTARQNSAFEKQSSDDKESDKRKPLTSDQ 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 80/288 (28%)
7tm_1 48..303 CDD:278431 71/272 (26%)
npffr2XP_002940397.1 7tm_1 60..331 CDD:278431 71/272 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1308959at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.