DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and prlhr

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_002940396.1 Gene:prlhr XenbaseID:XB-GENE-994391 Length:343 Species:Xenopus tropicalis

Alignment Length:298 Identity:71/299 (24%)
Similarity:135/299 (45%) Gaps:50/299 (17%)


  Fly    41 LIAF-GLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFY-QNYQLGCVG 103
            |:.| |::||:.::|||...:.:.:.||.::.|:|.:|:|..|.|..:.:...|. :.:..|...
 Frog    43 LVVFTGIFGNYLLIYVICRTKKMHNVTNFLVGNLAFSDMLMCATCVPLTLAYVFEPRGWVFGHFL 107

  Fly   104 CKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILLASPLAFYR 168
            |.....:..|.:..:|..|:|::.||..|.|.|:..||||.....::...|:...|:|:| |...
 Frog   108 CYFVFLMQPVTVYVSVFTLTVIAVDRYHATVYPLRRRLTIPTCAYILAGIWLLSCLMAAP-ALAH 171

  Fly   169 SYRVRVWKNFTERYCKENTSVLPKYW---------YVLITILVW--LPLGIMLICYIAIFYKLDR 222
            :|.|        .:.:.:.|:..::|         |...|:::.  ||..|:.:.|:.|..||  
 Frog   172 TYHV--------EFPQLDFSICEEFWFGMEKKRLAYAYSTLILTYALPFIIIALSYLRISVKL-- 226

  Fly   223 YEKRVLSRENPLTV------SYKRSVAKTLFIVVVVFAALRLPFTILVVLRE--------KYFGE 273
             :.||:. .|...|      :.::...:.|.:||..|....||..|..::::        :||  
 Frog   227 -KNRVVP-GNITNVQAEWDRARRKKTFRLLVLVVGAFGMCWLPLHIFNIMKDIDIHLIDKQYF-- 287

  Fly   274 DVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFR 311
                    .|...:..:|..::|..|.|:|.:.:::||
 Frog   288 --------NLVQLLCHWLAMMSACTNSLLYAWLHDSFR 317

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 70/296 (24%)
7tm_1 48..303 CDD:278431 65/281 (23%)
prlhrXP_002940396.1 7tm_4 43..>165 CDD:304433 34/122 (28%)
7tm_1 51..309 CDD:278431 65/281 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.