DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and LOC100491949

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_017951135.1 Gene:LOC100491949 ID: Length:303 Species:Xenopus tropicalis

Alignment Length:226 Identity:61/227 (27%)
Similarity:107/227 (47%) Gaps:28/227 (12%)


  Fly   133 IVLPMETRLTIRGVQIVVVCTWVSGILLASPLA---------FYRSYRVRVWKNFTERY-CKE-- 185
            ||.|...:||:|...|.::..||..:::..|.|         |:  :.|..:.|:...| |.|  
 Frog    13 IVYPFRQKLTLRKAIITIIIIWVLALIIMCPSAVTLTVTKDDFH--FMVDDYNNYYPLYSCWEEW 75

  Fly   186 -NTSVLPKYWYVLITILVWLPLGIMLICYIAIFYKLDRYEKRV---LSRENPLTVSYKRSVAKTL 246
             :|.:...|..||.:.:...||.:::|.|..|.:||.:....:   :|.||......||.| :.:
 Frog    76 PDTEMRKIYTTVLFSHIYLAPLTLIVIMYARIAFKLFKSSAPIRGSVSEENEGRRVSKRKV-RVI 139

  Fly   247 FIVVVV---FAALRLPFTILVVLREKYFGEDVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNE 308
            :::::|   |:...||...|::|.:.....|..::......:..:.:|.|.|::|||:|||:.||
 Frog   140 YMLIIVALFFSLSWLPLWTLMLLTDYGHLSDYQLNLIAVYVFPFAHWLAFFNSSVNPIIYGYFNE 204

  Fly   309 NFRRAYYQ------ISWVRRWRDATQMKKFS 333
            ||||.:.:      .|..|..|:....:|.|
 Frog   205 NFRRGFQEAFKVQVCSMKREHRETYSERKNS 235

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 56/201 (28%)
7tm_1 48..303 CDD:278431 48/189 (25%)
LOC100491949XP_017951135.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1308959at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.