DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and npy2r

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_001343301.3 Gene:npy2r / 100003852 ZFINID:ZDB-GENE-040924-8 Length:379 Species:Danio rerio


Alignment Length:370 Identity:101/370 - (27%)
Similarity:160/370 - (43%) Gaps:80/370 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQL 99
            |..:..:|.||:.||..::||:...|:|.:.||..|.|:||||||...:|....::...|..::.
Zfish    54 ILAYSTIIFFGMTGNSLVIYVVYKFRNLHTVTNYFIVNLAVADLLVNTLCLPFTLMYTLYGEWKF 118

  Fly   100 GCVGCKL----EGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILL 160
            |.|.|.|    :|..|.|..||    |:|::.||..:||..|||:::.....:|:..|||:..:|
Zfish   119 GQVMCYLLPYAQGLAVHVSTIT----LNVIALDRYRSIVYHMETKMSKDMCVVVIAITWVASAIL 179

  Fly   161 ASPLAFYRSYRV------RVWKNFTERYCKENTSVLPKYWYVLITILVWLPLGIMLICYIAIFYK 219
            |||||.:|.|..      :..:...|::...:|.. ..|...:..:...|||.|:...|..|:.|
Zfish   180 ASPLAIFREYVTFDLSPEQTIQGCAEKWPGSSTDG-TIYSIAMFFLQYGLPLSIISFAYTRIWNK 243

  Fly   220 L-----------DRYEKRVLSRENPLTVSYKRSVAKTLFIVVVVFAALRLPFTILVVLREKYFGE 273
            |           ||:::|             :...|.|..|||||....|||        ..|..
Zfish   244 LRNHVSPGGGRSDRHQRR-------------QKTTKMLVAVVVVFTVSWLPF--------HAFQL 287

  Fly   274 DVSVSSGM------QLFWYISQYLMFLNAAVNPLIYGFNNENFRRAYYQISWVRRWRDATQMKKF 332
            .|.:.|.:      :|.:.....:...:...||::||:.|.|:|.::..:              |
Zfish   288 AVDIDSSVLEMKDFKLLYTAFHIVAMCSTFANPILYGWMNRNYRGSFVAV--------------F 338

  Fly   333 SRSPDHCCYCAFMKNGKR---TSEAAQK--AGNLEKDISKDMSSA 372
            .        |..:.||.|   :|||.::  ..|||..||..::.|
Zfish   339 K--------CGRINNGMRRVSSSEAVREKCTRNLENTISIALTQA 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 85/297 (29%)
7tm_1 48..303 CDD:278431 78/281 (28%)
npy2rXP_001343301.3 7tm_GPCRs 51..334 CDD:333717 87/305 (29%)
TM helix 1 53..77 CDD:320095 8/22 (36%)
TM helix 2 86..108 CDD:320095 10/21 (48%)
TM helix 3 124..146 CDD:320095 8/25 (32%)
TM helix 4 167..183 CDD:320095 7/15 (47%)
TM helix 5 215..238 CDD:320095 5/22 (23%)
TM helix 6 262..287 CDD:320095 11/32 (34%)
TM helix 7 302..327 CDD:320095 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.