DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30340 and si:dkey-202l22.3

Sequence 1:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001108620.1 Gene:si:dkey-202l22.3 ZFINID:ZDB-GENE-131127-471 Length:377 Species:Danio rerio

Alignment Length:306 Identity:72/307 (23%)
Similarity:125/307 (41%) Gaps:43/307 (14%)


  Fly    38 FLPLIAFGL----YGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDF-YQNY 97
            |:||.|..:    .||..::..|..::.|.:.||..|.|:|..|||....|..:.....| .|.:
Zfish    41 FIPLYALVVVVAGVGNSFLLACILADKKLHNATNFFIGNLAAGDLLMCLSCVPLTASYAFDAQGW 105

  Fly    98 QLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILLAS 162
            ..|...|.|...:....:..:||:|:.::.||...:..|:..|:::.|...|.:..|...:.||:
Zfish   106 AFGRPMCHLIPLVQGATVFASVLSLTAIAMDRYVVVAYPVRRRISVWGCGAVALGVWAVSLALAA 170

  Fly   163 PLAFYRSY--------RVRVWKNFTERYCKENTSVLPKYWYVLITILVWLPLGIMLICYIAIFYK 219
            |.:.:..|        .:.|.:.|.  ...|...:|...:::|.:.::  ||..:.|.|.||...
Zfish   171 PPSLHTRYVDLRPSGMELVVCEEFW--LGAERQRLLYSCFFLLASYMI--PLLSVSISYCAISVH 231

  Fly   220 LDRYEKRVL----SRENPLTVSYKRSVAKTLFIVVVVFAALRLPFTILVVLREKYFGEDVSVSSG 280
            |   .|..|    |:........:|.....|...|:.||...||..:|.:|        :.:.|.
Zfish   232 L---RKHTLPGEPSQSQQRWSKQRRKTFSLLVASVLAFALCWLPLQVLNLL--------LDLDSD 285

  Fly   281 MQL-------FWYISQYLMFLNAA-VNPLIYGFNNENFR---RAYY 315
            .|:       ...:|.:|:.:::| .||.||...:...|   |.|:
Zfish   286 FQIVDKHYVNVLQVSCHLIAMSSACYNPFIYASLHSKVRMHLRGYF 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 68/299 (23%)
7tm_1 48..303 CDD:278431 64/276 (23%)
si:dkey-202l22.3NP_001108620.1 7tm_1 56..316 CDD:278431 63/275 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.