DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30338 and rwdd2b

Sequence 1:NP_724811.1 Gene:CG30338 FlyBaseID:FBgn0050338 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_012812734.1 Gene:rwdd2b XenbaseID:XB-GENE-963133 Length:309 Species:Xenopus tropicalis

Alignment Length:307 Identity:91/308 (30%)
Similarity:145/308 (47%) Gaps:37/308 (12%)


  Fly     1 MADEELQTYRRCVGLQLEELELLSSIYCAPGELHMLDAGVVADFNEFLKDDKTKPATSL-LSHLE 64
            |:.||::.       ||.||:||||::....|..:.|...:|:    |:|...|.|:|. .|.::
 Frog    17 MSLEEIEA-------QLSELDLLSSMFPTEDEFVVTDQVALAE----LRDYAEKRASSAPSSKIQ 70

  Fly    65 YVVKLTLPGKQCVEVRVELPHLYPL---LEQARVSVHTTLLGKSKEQRLKNDLEQYHGERREEDA 126
            :.|.:.:.....|:..:.|...|||   .....:.|.:..|.:|::.:|..||..|.......|.
 Frog    71 FTVNVKVEESDKVKQELGLHCSYPLQYPTVPPEILVRSPSLVRSQQAQLNLDLSNYLKSNCSGDV 135

  Fly   127 EPYIFQLLSWLQDRIEDLLKRPASEFEVQQVASSDPQQPPATELQRIWIYSHHIKSSAKRQELIR 191
              .|.....|::|...:.||..|...|.|    :||..|......|:|||||||.:..||:.::.
 Frog   136 --CILSATEWVRDNAFNYLKDTAPLSEPQ----TDPGSPDNATFTRLWIYSHHIYNKVKRKHILE 194

  Fly   192 QARQLELTGFSRPGKPGIICVEGDSANVQEFWRTIKALRWQKISVVRTE-------------PRQ 243
            .::::||:|||.||||||:||||.....:|||..::.|.|::|.:...|             ..|
 Frog   195 WSKEMELSGFSMPGKPGIVCVEGRRYLCEEFWNRLRKLTWRRIMIRHREDIPLPGAPCDISKEIQ 259

  Fly   244 RKRGFEDFSEQLFN---AEEGVMNMGQFIRFLEAHGFGYMKSELFGL 287
            :.|.|....|:.|:   |....|::||..:||..:|...:....||:
 Frog   260 KMRKFPPLEEKAFDVHGARGNHMDLGQLYQFLNEYGCADIFPMYFGI 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30338NP_724811.1 DUF1115 175..>240 CDD:284060 29/65 (45%)
rwdd2bXP_012812734.1 RWD 23..148 CDD:283440 34/138 (25%)
DUF1115 178..303 CDD:284060 42/125 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244823487
eggNOG 1 0.900 E1_28IR6
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1387276at2759
OrthoFinder 1 1.000 FOG0003468
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.634 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.