DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30338 and Rwdd2a

Sequence 1:NP_724811.1 Gene:CG30338 FlyBaseID:FBgn0050338 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001139440.1 Gene:Rwdd2a MGIID:1916769 Length:292 Species:Mus musculus

Alignment Length:307 Identity:96/308 (31%)
Similarity:149/308 (48%) Gaps:51/308 (17%)


  Fly     4 EELQTYRRCVGLQLEELELLSSIYCAPGELHMLDAGVVADFNEFLKDDKTKPATSLLSHLEYVVK 68
            |.||       |||.|:|:|.|::...||:.:.|...:.:...:|:..:    .:|..::|:|:.
Mouse     7 ESLQ-------LQLLEMEMLFSMFPNQGEVKLEDVNALTNIKRYLEGTR----EALPPNIEFVIT 60

  Fly    69 LTL-PGKQCVEVRVELPHLYPLLEQARVSVHTTLLGKSKE-----QRLKND-LEQYHGERREEDA 126
            |.: ..|..::::|.:||.||.       |...|.|:|.|     |.|.|. |..|.|  ..:..
Mouse    61 LQIEEPKVTIDLQVTMPHNYPY-------VALQLFGRSPELDRQQQLLLNQALSAYLG--TFDPG 116

  Fly   127 EPYIFQLLSWLQDRIEDLLKRPASEFEVQQVASSDPQ---QPPATELQRIWIYSHHIKSSAKRQE 188
            |..:...:.||||       ..||.|..::: |.:|.   :|......|:|||||||.....|::
Mouse   117 ELCVCAAIQWLQD-------NSASYFLTRKL-SDEPSVQAKPVKNTFLRMWIYSHHIYQQDLRKK 173

  Fly   189 LIRQARQLELTGFSRPGKPGIICVEGDSANVQEFWRTIKALRWQKISVVRTEPRQRK------RG 247
            ::...::|::|||...||||||||||...:.:|||.||:...|:.||....|..:.:      |.
Mouse   174 ILEVGKRLDVTGFCMTGKPGIICVEGFKNHCEEFWHTIRYPNWKHISCKHAESVETEGDGEDLRL 238

  Fly   248 FEDFSEQLFNA--EEGV-----MNMGQFIRFLEAHGFGYMKSELFGL 287
            |..|.|.|..|  :.|:     ||:|||:.||..|...::...|||:
Mouse   239 FHSFEELLLEAHGDYGLRNDYHMNLGQFLEFLRKHKSEHVFQILFGI 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30338NP_724811.1 DUF1115 175..>240 CDD:284060 29/65 (45%)
Rwdd2aNP_001139440.1 RWD 7..130 CDD:283440 40/150 (27%)
DUF1115 160..281 CDD:284060 45/121 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244816298
eggNOG 1 0.900 E1_28IR6
Hieranoid 1 1.000
Homologene 1 1.000 H12315
Inparanoid 1 1.050 120 1.000 Inparanoid score I4722
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003468
OrthoInspector 1 1.000 T615944
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15955
Phylome 1 0.910 0.639 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5060
TreeFam 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.