DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30338 and Rwdd3

Sequence 1:NP_724811.1 Gene:CG30338 FlyBaseID:FBgn0050338 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_079913.2 Gene:Rwdd3 MGIID:1920420 Length:339 Species:Mus musculus

Alignment Length:298 Identity:69/299 (23%)
Similarity:112/299 (37%) Gaps:92/299 (31%)


  Fly    18 EELELLSSIYCAPGELHMLDAGVVADFNEFLKDDKTKP--ATSLLS----HLEYVVKLTLPGKQC 76
            :||..|::|:|.|.|..||..          .|....|  .|.||.    |.:::...:|...:|
Mouse     7 QELSALAAIFCGPNEWEMLSC----------SDGAQCPPRETQLLQIVGIHHKHLCITSLTTGRC 61

  Fly    77 -------VEVRVELPHLY--------------------PLLEQARVSVHTT---LLGKSKEQRLK 111
                   ..||..|..|.                    |..:.|...:|||   |:|:.....|.
Mouse    62 SWLSATWKAVRKCLLRLLKNGSRFQTSAGRSMETFSSNPETDGAVFRIHTTAEGLVGEDVPLELA 126

  Fly   112 NDL---------------------------EQYHGERREEDAEPYIFQLLSWLQDRIEDLLKRP- 148
            ..|                           |:..||.|:..:||.:.:|:.|:|..:..:|.:| 
Mouse   127 FHLPVGYPLCLPGISVTSEHLTRAQCVTAKEKLLGEARKLVSEPMVHELVLWIQQNLRLVLSQPE 191

  Fly   149 -ASEFE---VQQVASSDPQQPPATELQRIWIYSHHIKSSAKRQELIRQ-ARQLELTG-FSRPGKP 207
             ||..|   :.:.|:.|  ..|...|.|:    .|:::..|..:.:.: |.:|.||| ....||.
Mouse   192 TASSHEKCTLPESATGD--DGPWMTLLRL----DHMRARTKYVKAVEKWASELRLTGRLMFMGKL 250

  Fly   208 GIICVEGDSANVQEFWRTIKALRWQKISVVRTEPRQRK 245
            .:|.::||.:|::|:      |..||.|.|..:...:|
Mouse   251 ILILLQGDRSNIKEY------LILQKTSKVDVDSSGKK 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30338NP_724811.1 DUF1115 175..>240 CDD:284060 19/67 (28%)
Rwdd3NP_079913.2 RWD <97..183 CDD:283440 18/86 (21%)
DUF1115 231..>270 CDD:284060 14/45 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.870

Return to query results.
Submit another query.