DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30338 and rwdd2b

Sequence 1:NP_724811.1 Gene:CG30338 FlyBaseID:FBgn0050338 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001068583.1 Gene:rwdd2b ZFINID:ZDB-GENE-041001-119 Length:289 Species:Danio rerio

Alignment Length:292 Identity:88/293 (30%)
Similarity:140/293 (48%) Gaps:35/293 (12%)


  Fly    16 QLEELELLSSIYCAPGELHM-LDAGVVADFNEFLKDDKTKPATSLLSHLEYVVKLTLPGKQCVEV 79
            ||.|:|||.|::  |.|..: :|....|:...:::.....|.|| ......:||:..|. .|:.:
Zfish    10 QLAEIELLISMF--PSEEGLQVDEISHAELRAYVEGSAHTPPTS-RPQFSIMVKVENPA-ACITM 70

  Fly    80 RVELPHLYPLLEQARVSVHTTLLGKSKEQRLKNDLEQYHGERREEDAEPYIFQLLSWLQDRIEDL 144
            ....|:.|| .|...::|....|.:|::.:|.:||..|..|...  .|..:...:.|::|.    
Zfish    71 VCSYPNDYP-KELPDITVRCAELIRSQQMQLHSDLNNYLTENCR--GEVCVLSAVQWIKDN---- 128

  Fly   145 LKRPASEFEVQQVASSDPQQ-----PPATELQRIWIYSHHIKSSAKRQELIRQARQLELTGFSRP 204
                |..:..:..|.|:|::     .|.|...|:|||||||.:..||:.::..|::|.|:|||.|
Zfish   129 ----ACLYFTKSAAFSEPKKEHALTQPKTTFTRLWIYSHHIYNKIKRKNILEWAKELNLSGFSMP 189

  Fly   205 GKPGIICVEGDSANVQEFWRTIKALRWQKISVVR----------TEPR-QRKRGFEDFSEQLF-- 256
            |||||:||||..:...|||..:|.|.|::|.:..          ||.| :..|.|..|.|.:|  
Zfish   190 GKPGIVCVEGLQSVCDEFWARLKVLTWKRIMIRHREDVPLDSSWTEERIESLRKFTLFHEAIFYP 254

  Fly   257 -NAEEGVMNMGQFIRFLEAHGFGYMKSELFGL 287
             ..:...|::||..:||...|...:....||:
Zfish   255 HGTKGNHMDLGQLYQFLNDKGCADIFQLYFGI 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30338NP_724811.1 DUF1115 175..>240 CDD:284060 32/75 (43%)
rwdd2bNP_001068583.1 RWD 8..129 CDD:283440 33/134 (25%)
DUF1115 160..283 CDD:284060 45/123 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244825617
eggNOG 1 0.900 E1_28IR6
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1387276at2759
OrthoFinder 1 1.000 FOG0003468
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_134629
Panther 1 1.100 O PTHR15955
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.