DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30338 and Rwdd2b

Sequence 1:NP_724811.1 Gene:CG30338 FlyBaseID:FBgn0050338 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_058620.2 Gene:Rwdd2b MGIID:1858215 Length:290 Species:Mus musculus

Alignment Length:288 Identity:83/289 (29%)
Similarity:139/289 (48%) Gaps:26/289 (9%)


  Fly    16 QLEELELLSSIYCAPGELHMLDAGVVADFNEFLKDDKTKPATSLLSHLEYVVKLTLPGKQCVEVR 80
            ||.||:||:|::.:..||.:.|...:|:..:.: :.:|....|  |.:.:.:.::|...:...|.
Mouse    10 QLSELDLLASMFPSENELIVNDQLALAELKDCI-EKRTMEGRS--SQVYFTINVSLDLSEAAVVT 71

  Fly    81 VE----LPHLYPLLEQARVSVHTTLLGKSKEQRLKNDLEQYHGERREEDAEPYIFQLLSWLQDRI 141
            ..    ||..||.: ...::|.:..|.:|::.:|..||..|..:....|.  .|.....|:::..
Mouse    72 FSLSCILPFKYPTV-LPEITVRSVSLSRSQQTQLNTDLIAYLQKNCLGDV--CILNATEWVKEHA 133

  Fly   142 EDLLKRPASEFEVQQVASSDPQQPPATELQRIWIYSHHIKSSAKRQELIRQARQLELTGFSRPGK 206
            .|.:...|    :...|.....||......|:|||||||.:..||:.::..|::|.|||||.|||
Mouse   134 FDYVNIEA----LPSPARQSTAQPEDLAFTRLWIYSHHIYNKCKRRNILEWAKELSLTGFSMPGK 194

  Fly   207 PGIICVEGDSANVQEFWRTIKALRWQKISVVRTEP---------RQRKRGFEDFSEQLFN---AE 259
            ||::||||..:..:|||..::.|.|::|.:...|.         .:.:|.|....|:.|:   |.
Mouse   195 PGVVCVEGPQSACEEFWSRLRKLNWKRILIRHREDIPLDGTAGGMEGQRKFPILEEKAFSVHGAR 259

  Fly   260 EGVMNMGQFIRFLEAHGFGYMKSELFGL 287
            ...|:.||..:||.|.|.|.:....||:
Mouse   260 GNHMDFGQLYQFLNARGCGDVFQMFFGV 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30338NP_724811.1 DUF1115 175..>240 CDD:284060 30/65 (46%)
Rwdd2bNP_058620.2 RWD 13..136 CDD:214735 29/129 (22%)
DUF1115 163..>222 CDD:284060 29/59 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244816565
eggNOG 1 0.900 E1_28IR6
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I4722
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1387276at2759
OrthoFinder 1 1.000 FOG0003468
OrthoInspector 1 1.000 T615944
orthoMCL 1 0.900 OOG5_134629
Panther 1 1.100 O PTHR15955
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5060
TreeFam 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.