DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30338 and Rwdd2a

Sequence 1:NP_724811.1 Gene:CG30338 FlyBaseID:FBgn0050338 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001102243.1 Gene:Rwdd2a RGDID:1306231 Length:292 Species:Rattus norvegicus

Alignment Length:307 Identity:96/308 (31%)
Similarity:149/308 (48%) Gaps:51/308 (17%)


  Fly     4 EELQTYRRCVGLQLEELELLSSIYCAPGELHMLDAGVVADFNEFLKDDKTKPATSLLSHLEYVVK 68
            |.||       |||.|:|:|.|::...||:.:.|...:.:...:|  |.|:.|  |..::|:|:.
  Rat     7 ESLQ-------LQLLEMEMLFSMFPNQGEVKLEDVNALTNIKRYL--DGTREA--LPPNIEFVIT 60

  Fly    69 LTL-PGKQCVEVRVELPHLYPLLEQARVSVHTTLLGKSKE-----QRLKND-LEQYHGERREEDA 126
            |.: ..|..::::|.:||.||.       |...|.|:|.|     |.|.|. |..|.|  ..:..
  Rat    61 LQIEEPKVTIDLQVTMPHSYPY-------VALQLFGRSPELDRQQQLLLNQGLSAYLG--TFDPG 116

  Fly   127 EPYIFQLLSWLQDRIEDLLKRPASEFEVQQVASSDPQ---QPPATELQRIWIYSHHIKSSAKRQE 188
            |..:...:.||||.        ::.:.:.:..|.:|.   :|......|:|||||||.....|::
  Rat   117 ELCVCAAIQWLQDN--------SASYFLNRKLSDEPSVQPKPVKNTFLRMWIYSHHIYQQDLRKK 173

  Fly   189 LIRQARQLELTGFSRPGKPGIICVEGDSANVQEFWRTIKALRWQKISVVRTEPRQRK------RG 247
            ::...::|::|||...||||||||||...:.:|||.||:...|:.||....|..:.:      |.
  Rat   174 ILEVGKRLDVTGFCMTGKPGIICVEGFKDHCEEFWHTIRYPNWKHISCKHAETVETEGDGEDLRL 238

  Fly   248 FEDFSEQLFNA--EEGV-----MNMGQFIRFLEAHGFGYMKSELFGL 287
            |..|.|.|..|  :.|:     ||:|||:.||..|...::...|||:
  Rat   239 FHSFEELLLEAHGDYGLRNDYHMNLGQFLEFLRKHKSEHVFQILFGI 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30338NP_724811.1 DUF1115 175..>240 CDD:284060 29/65 (45%)
Rwdd2aNP_001102243.1 RWD 7..130 CDD:283440 43/143 (30%)
DUF1115 160..281 CDD:284060 45/121 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244817177
eggNOG 1 0.900 E1_28IR6
Hieranoid 1 1.000
Homologene 1 1.000 H12315
Inparanoid 1 1.050 133 1.000 Inparanoid score I4438
OMA 1 1.010
OrthoDB 1 1.010 D1387276at2759
OrthoFinder 1 1.000 FOG0003468
OrthoInspector 1 1.000 T618058
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15955
Phylome 1 0.910 0.647 Consistency score
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.