DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30338 and Rwdd2b

Sequence 1:NP_724811.1 Gene:CG30338 FlyBaseID:FBgn0050338 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001094029.1 Gene:Rwdd2b RGDID:1305062 Length:290 Species:Rattus norvegicus

Alignment Length:289 Identity:89/290 (31%)
Similarity:145/290 (50%) Gaps:28/290 (10%)


  Fly    16 QLEELELLSSIYCAPGELHMLDAGVVADFNEFLKDDKTKPATSLLSHLEYVVKLTLPGKQCVEVR 80
            ||.||:||:|::....||.:.|...:|:..:.: :.:|....|  |.:.:.:.::|...:...|.
  Rat    10 QLSELDLLASMFPGENELIVNDQLALAELKDCI-EKRTMEGRS--SKVYFTINVSLDFNEAAMVM 71

  Fly    81 VE----LPHLYPLLEQARVSVHTTLLGKSKEQRLKNDLEQYHGERREEDAEPYIFQLLSWLQDRI 141
            ..    ||..||.: ...::|.:..|.:|::.:|..||..|  .::....|..|.....|:::..
  Rat    72 FSLSCILPFKYPTV-LPEITVRSVSLSRSQQTQLNTDLTAY--LQKHCLGEVCILNATEWVKEHA 133

  Fly   142 EDLLKRPASEFEVQQVASSDPQQPPATELQRIWIYSHHIKSSAKRQELIRQARQLELTGFSRPGK 206
            .|.:.|.||....:|    ...||......|:|||||||.:..||:.::..||:|.|:|||.|||
  Rat   134 SDYVNRDASPSPARQ----STVQPVDLTFTRLWIYSHHIYNKCKRRNILEWARELSLSGFSMPGK 194

  Fly   207 PGIICVEGDSANVQEFWRTIKALRWQKISVVR----------TEPRQRKRGFEDFSEQLFN---A 258
            ||::||||..:..:|||..::.|.|::| ::|          ||..:.:|.|..|.|:.||   |
  Rat   195 PGVVCVEGPQSACEEFWSRLRKLNWKRI-LIRHREDIPFDSTTEKMEEQRKFSIFEEKAFNVHGA 258

  Fly   259 EEGVMNMGQFIRFLEAHGFGYMKSELFGL 287
            ....|:.||..:||.|.|.|.:....||:
  Rat   259 RGNHMDFGQLYQFLNARGCGDVFQMFFGV 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30338NP_724811.1 DUF1115 175..>240 CDD:284060 32/75 (43%)
Rwdd2bNP_001094029.1 RWD 13..136 CDD:214735 29/129 (22%)
DUF1115 163..>222 CDD:284060 29/59 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244825770
eggNOG 1 0.900 E1_28IR6
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4438
OMA 1 1.010
OrthoDB 1 1.010 D1387276at2759
OrthoFinder 1 1.000 FOG0003468
OrthoInspector 1 1.000 T618058
orthoMCL 1 0.900 OOG5_134629
Panther 1 1.100 O PTHR15955
Phylome 1 0.910 0.658 Consistency score
TreeFam 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.