DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30338 and RWDD2A

Sequence 1:NP_724811.1 Gene:CG30338 FlyBaseID:FBgn0050338 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_219479.2 Gene:RWDD2A HGNCID:21385 Length:292 Species:Homo sapiens

Alignment Length:306 Identity:95/307 (31%)
Similarity:147/307 (48%) Gaps:49/307 (16%)


  Fly     4 EELQTYRRCVGLQLEELELLSSIYCAPGELHMLDAGVVADFNEFLKDDKTKPATSLLSHLEYVVK 68
            |.||       |||.|:|:|.|::...||:.:.|...:.:...:|:..:    .:|...:|:|:.
Human     7 ESLQ-------LQLLEMEMLFSMFPNQGEVKLEDVNALTNIKRYLEGTR----EALPPKIEFVIT 60

  Fly    69 LTL-PGKQCVEVRVELPHLYPLLEQARVSVHTTLLGKSKE-----QRLKN-DLEQYHGERREEDA 126
            |.: ..|..::::|.:||.||.       |...|.|:|.|     |.|.| .|..|.|  ..:..
Human    61 LQIEEPKVKIDLQVTMPHSYPY-------VALQLFGRSSELDRHQQLLLNKGLTSYIG--TFDPG 116

  Fly   127 EPYIFQLLSWLQDRIEDLLKRPASEFEVQQVA--SSDPQQPPATELQRIWIYSHHIKSSAKRQEL 189
            |..:...:.||||       ..||.|..:::.  .|...:|......|:|||||||.....|:::
Human   117 ELCVCAAIQWLQD-------NSASYFLNRKLVYEPSTQAKPVKNTFLRMWIYSHHIYQQDLRKKI 174

  Fly   190 IRQARQLELTGFSRPGKPGIICVEGDSANVQEFWRTIKALRWQKISVVRTEPRQRK------RGF 248
            :...::|::|||...||||||||||...:.:|||.||:...|:.||....|..:.:      |.|
Human   175 LDVGKRLDVTGFCMTGKPGIICVEGFKEHCEEFWHTIRYPNWKHISCKHAESVETEGNGEDLRLF 239

  Fly   249 EDFSEQLFNA--EEGV-----MNMGQFIRFLEAHGFGYMKSELFGL 287
            ..|.|.|..|  :.|:     ||:|||:.||:.|...::...|||:
Human   240 HSFEELLLEAHGDYGLRNDYHMNLGQFLEFLKKHKSEHVFQILFGI 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30338NP_724811.1 DUF1115 175..>240 CDD:284060 29/65 (45%)
RWDD2ANP_219479.2 RWD 15..134 CDD:214735 36/139 (26%)
DUF1115 160..279 CDD:310859 45/119 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244823307
eggNOG 1 0.900 E1_28IR6
Hieranoid 1 1.000
Homologene 1 1.000 H12315
Inparanoid 1 1.050 120 1.000 Inparanoid score I4687
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1387276at2759
OrthoFinder 1 1.000 FOG0003468
OrthoInspector 1 1.000 T609121
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15955
Phylome 1 0.910 0.639 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5060
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.