DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30338 and RWDD2B

Sequence 1:NP_724811.1 Gene:CG30338 FlyBaseID:FBgn0050338 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_058636.1 Gene:RWDD2B HGNCID:1302 Length:319 Species:Homo sapiens

Alignment Length:303 Identity:85/304 (28%)
Similarity:141/304 (46%) Gaps:56/304 (18%)


  Fly    16 QLEELELLSSIYCAPGELHMLDAGVVADFNEFLKDDKTKPATSLLSHLEYVV---------KLTL 71
            ||.||:||:|::....||.:.|...||:..:.: :.||....|  |.:.:.:         |:.:
Human    39 QLAELDLLASMFPGENELIVNDQLAVAELKDCI-EKKTMEGRS--SKVYFTINMNLDVSDEKMAM 100

  Fly    72 PGKQCVEVRVELPHLYPLLEQARVSVHTTLLGKSKEQRLKNDLEQY-----HGERREEDAEPYIF 131
            ....|:     ||..||.: ...::|.:.||.:|::.:|..||..:     ||       :..|.
Human   101 FSLACI-----LPFKYPAV-LPEITVRSVLLSRSQQTQLNTDLTAFLQKHCHG-------DVCIL 152

  Fly   132 QLLSWLQDRIEDLLKRPASEFEVQQVASSDPQQPPATE-----LQRIWIYSHHIKSSAKRQELIR 191
            ....|:::.....:.|.         .||.|......:     ..|:|||||||.:..||:.::.
Human   153 NATEWVREHASGYVSRD---------TSSSPTTGSTVQSVDLIFTRLWIYSHHIYNKCKRKNILE 208

  Fly   192 QARQLELTGFSRPGKPGIICVEGDSANVQEFWRTIKALRWQKISVVRTE---------PRQRKRG 247
            .|::|.|:|||.|||||::||||..:..:|||..::.|.|::|.:...|         ..:|:|.
Human   209 WAKELSLSGFSMPGKPGVVCVEGPQSACEEFWSRLRKLNWKRILIRHREDIPFDGTNDETERQRK 273

  Fly   248 FEDFSEQLFN---AEEGVMNMGQFIRFLEAHGFGYMKSELFGL 287
            |..|.|::|:   |....|:.||..:||...|.|.:....||:
Human   274 FSIFEEKVFSVNGARGNHMDFGQLYQFLNTKGCGDVFQMFFGV 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30338NP_724811.1 DUF1115 175..>240 CDD:284060 29/65 (45%)
RWDD2BNP_058636.1 RWD 37..162 CDD:310403 33/139 (24%)
DUF1115 192..310 CDD:310859 44/118 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244824287
eggNOG 1 0.900 E1_28IR6
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I4687
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1387276at2759
OrthoFinder 1 1.000 FOG0003468
OrthoInspector 1 1.000 T609121
orthoMCL 1 0.900 OOG5_134629
Panther 1 1.100 O PTHR15955
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5060
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.