DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30338 and rwdd2a

Sequence 1:NP_724811.1 Gene:CG30338 FlyBaseID:FBgn0050338 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001106449.1 Gene:rwdd2a XenbaseID:XB-GENE-945825 Length:288 Species:Xenopus tropicalis

Alignment Length:305 Identity:90/306 (29%)
Similarity:148/306 (48%) Gaps:49/306 (16%)


  Fly     8 TYRRCVGLQLEELELLSSIYCAPG-ELHMLDAGVVADFNEFLKDDKTKPATSLLSHLEYVVKLTL 71
            |.|.|:.|||.|:|:|.|::  |. ||.:.:...:.....:|:..:    .||.|.:|:::.:.:
 Frog     4 TTRECLELQLLEMEMLLSMF--PNKELVLENPNSILHTRRYLEGIR----ESLPSIIEFLIFVNV 62

  Fly    72 PGKQC-VEVRVELPHLYPLLEQARVSVHTTLLGKSKEQRLKNDLEQY-HGERREEDAEPYIFQLL 134
            ...:. .|:.|.|||.|| .|:.:|.|.:..|.:.::..|..:|..| |...|   .|..|....
 Frog    63 QKSEVKAEMHVSLPHSYP-QEEPQVFVRSVALDRQQQNFLNKELVSYIHSLDR---GELCISIAA 123

  Fly   135 SWLQDRIEDLLKRPASEFEVQQVASSDPQQPPATELQ-------RIWIYSHHIKSSAKRQELIRQ 192
            .||||.|...::            :|.....|..|::       |:|||||||.....|::::..
 Frog   124 QWLQDNISTYIQ------------NSKQNDEPECEIKEATYTFHRMWIYSHHIYRQELRKKILDY 176

  Fly   193 ARQLELTGFSRPGKPGIICVEGDSANVQEFWRTIKALRWQKISVVRTEPRQRKRGFEDFSEQLFN 257
            |::|.||||...||||:||:||.....:||||.|:...|:.||...:|.::.....:|.  :|||
 Frog   177 AKRLNLTGFCLTGKPGVICIEGVKEQCEEFWRDIRYPNWKHISCKHSESKEVTGKIDDL--RLFN 239

  Fly   258 AEEGV---------------MNMGQFIRFLEAHGFGYMKSELFGL 287
            :.|.:               |::|||:.:|:.|...::...|||:
 Frog   240 SFEELALTAHGDYGLRNDYHMDLGQFLEYLKQHKSEHIFHILFGV 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30338NP_724811.1 DUF1115 175..>240 CDD:284060 29/65 (45%)
rwdd2aNP_001106449.1 RWD 21..130 CDD:310403 31/119 (26%)
DUF1115 159..278 CDD:310859 41/121 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244824336
eggNOG 1 0.900 E1_28IR6
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H12315
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1387276at2759
OrthoFinder 1 1.000 FOG0003468
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.634 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5060
TreeFam 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.