DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30285 and CG13749

Sequence 1:NP_726103.1 Gene:CG30285 FlyBaseID:FBgn0050285 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_610428.2 Gene:CG13749 FlyBaseID:FBgn0033353 Length:183 Species:Drosophila melanogaster

Alignment Length:91 Identity:41/92 (45%)
Similarity:50/92 (54%) Gaps:13/92 (14%)


  Fly    17 AVTNAQQNYDGRNGPHEFGTPGNGIYIRGQNEGPYTVPEMGGTFQNSPSSGQHSYTDEHGNTYTH 81
            :..:.|:.|||.:|||.||||||.:||||||:|.|.||.:||.|.::.|...|.||||.|.||.|
  Fly    16 SAADLQRTYDGHDGPHVFGTPGNQVYIRGQNDGVYKVPGVGGQFHHASSPADHVYTDEQGITYVH 80

  Fly    82 SSTA-------------TVTSLAYST 94
            ...|             .....||||
  Fly    81 KKDAGGPGTHTLRGPGLAAVQPAYST 106



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131113630
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.