DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30275 and Cfap61

Sequence 1:NP_788430.3 Gene:CG30275 FlyBaseID:FBgn0050275 Length:1298 Species:Drosophila melanogaster
Sequence 2:NP_001356050.1 Gene:Cfap61 MGIID:1926024 Length:1230 Species:Mus musculus

Alignment Length:1371 Identity:284/1372 (21%)
Similarity:526/1372 (38%) Gaps:262/1372 (19%)


  Fly     7 RLAQAGDQDGLNKLIRSPGVKWFGNIRPKFRGKDSLFNSYQTYRILAFCTESSALVAYAEFRNYP 71
            |..::.|...:..|:|....|.||.:       :.::...:....:..|.:...::|::.|.:||
Mouse    17 RRTESQDIFCIKNLVRKFTQKLFGRL-------NIIYLLEKANLAVTVCNDKEEIMAHSIFLDYP 74

  Fly    72 SIAALPTDCWLEWLSTRYCLSMSISWLNALFFNFCVYKSDQSP-VLVEIIKDVLYRESRVWFLIT 135
            :......|.|:. |.......:..:.||.||.:|.|...:.:. .|.|||:.|......::|:..
Mouse    75 NWNVAKQDNWIP-LFRELDKEIPCTPLNTLFMHFFVAVDEYATGCLKEIIRTVFKAVPELYFIFL 138

  Fly   136 VRCPYVPQPIHFVETFDDLEKISQVFYPLEYSMDKNNNTQSLYIVDRFVILPRITYRKALAEDND 200
            :...|:......:..||.:..|..:.|         |...:::|..|....|::..|||..||:|
Mouse   139 IVPTYLSLGSTLITVFDQVGNIPCLNY---------NEDFAVHICHRHNHYPQLHIRKARVEDHD 194

  Fly   201 DIIAMQEVENPEMREELGDYYIAEEVMGQNPKSMLVVAETINQSQESEMAIFLWLSSDIDIMFYV 265
            |::.:....:..::|..|:|::||.:..|:.....||.|.     |.:...|:.:.:.:::....
Mouse   195 DLMPIFMHYDNTLKEIYGEYFLAELIEAQDKDHHAVVCEV-----EGKAVGFMSVCTSVNLPLLH 254

  Fly   266 RNYEMEQF--------GNLVKPADGRSF----------------HYETMTVSSVQRRAEASMFTA 306
            ..:::..|        .:::||:...|.                ..|.....:.::..|.|....
Mouse   255 ECFDLGPFHGFCTPHPDDILKPSREPSLEEGEDAESQGSPKVVEEQEMAPEITQEKETETSASCE 319

  Fly   307 DALDDLNAVTILGGL------QKVDSGMSVASLGKMKVSSIGGTIVDTNVANENKFYMRECLYSK 365
            :||.     |:||.:      |.::..:|:.||           :.:.:||:.        |.|.
Mouse   320 EALP-----TVLGLVSEERLKQDMEKNLSILSL-----------VDEEDVASS--------LSSS 360

  Fly   366 FKYILEKLHSTDYYLRHEQSVINFIYPAGTEPAGPAAMAAASNVFLLRCIVARQDFPLPRLFNAM 430
            ....:|..|....||                 ..|.|..     ..|.||..|.:   .|..:.|
Mouse   361 LLLSVESSHFRPLYL-----------------GDPIAFC-----IQLFCIDERYE---ARSLDFM 400

  Fly   431 VAIFSAYPDRDYCMMLMSVKYKASKSYLEVMQYFMPVASRPSNLSSLD-DVFITHRSTIFGEISL 494
            ..:||.:|.:::|  |:||.:...:..|  :|.|:.|.  |.|..:|| |:::.||:.:...|::
Mouse   401 SFVFSLFPGKNFC--LISVPHLTPEFVL--IQNFVKVV--PFNNCTLDHDLYVFHRAGLLRSITI 459

  Fly   495 YKLEKEDVAHVHKLALGNLPSNTQTPNSSSSSFSYCSKVNE--REELEHELHVLDAIMKDVLENE 557
            ...:..|.|.|.||        ..|...|:......::.||  |:.....|.|..|.:.|.:   
Mouse   460 RLAKFLDTAGVEKL--------VSTLLLSTKILDDLAQYNEAGRDPDGTALQVFVAEVADQI--- 513

  Fly   558 FSEFAVFTIRCGISTRSVRENTAIGFVIVREFHSHEKLFEHYHLPKQEYQLNRRRAE---IISLR 619
                                   :|..::|:....|.:..||::....|..:.::.|   :....
Mouse   514 -----------------------VGIAVIRKEMDIEYIRSHYNIEDFIYFSHHQQEEHGRLNHFA 555

  Fly   620 LHPLFLVSAGLIFRDLAR---KTSFYDYYFIHSVDG---YKYSNDLKKMMMVVEPKPIKKVPVFT 678
            |:|:|........:::.|   |:..|...:..:.:|   ..||:.|...:..:       |||..
Mouse   556 LNPIFRHYTKFFLKEILRLGYKSCLYYPVYPQTREGKLQSSYSHSLTSALHYL-------VPVRP 613

  Fly   679 RVQANHKKPRKKLDLPPPNFSRDNL-IIYRH---KLNPVKWFTNSQKLVIIGFSAVTKAFLRQLV 739
            |.|..:...:..::.|....|:|.: ....|   ||......|.:.::|::|.|:|..:||..||
Mouse   614 RRQIVYPLEKLGINAPSKEVSKDQVSFALNHTNRKLTLEPKVTVNARIVVVGASSVGISFLETLV 678

  Fly   740 FQWNSKDHKNSENFTCLTRLQVTVICRAGIVEADYDSLFKCPYCTNRQGCYLSYRNESCYVRDCC 804
            |..:.|       |..||.:....:....::..:........:|.|.:...|             
Mouse   679 FCSHLK-------FNNLTLISTHGLPGKRLLHNEQRKFLASDHCFNDKDYAL------------- 723

  Fly   805 MRIDLRCWVHFVPGKVEKVDRDKKFVKLDSCEI-YYDTLLLMCDRMFVLRC-------------- 854
              :.|..||:.|.|::..:||..|.|.:...|| :||.|:|.....:.:.|              
Mouse   724 --MSLCSWVNVVVGRMTAIDRAAKQVVVSKSEIVFYDHLILCTGLQYQVPCPTGADTEQHLTNRE 786

  Fly   855 ---IDVPVYSPR-PCNLVEINFRLN------KFLLFYKVRALLEDMPRTYLVLVYGNNLHTYECI 909
               :....|:.. |.||    |.||      :.|.:.:..::|.:..    |:||||.|..|..:
Mouse   787 VLELSKQRYTGTVPSNL----FILNDEEDCVRMLCWLRNSSILTEGK----VIVYGNTLDAYTTV 843

  Fly   910 AFLIGHGVDCSRMVFVQPHRITGRDADMKEKCPYWDKNLQMIMDDILVEKGVNIFTDYDFHHYNL 974
            ..|:..|:..|.:.||.|      ..:....| ..:.:::..::|.|...||.:|.|.....:|.
Mouse   844 ETLLNIGMKGSGIYFVHP------PTESNITC-INNNDVESAVEDALSAAGVTVFHDALLAQWNH 901

  Fly   975 HKSTDFIMEVIFQHFPTQKQMTFECDLFISFQEGHLHQRHKQWLENAGIELDGNQILVNERYQTN 1039
            .:..|.|....|.  .:.|.:..||..|.||.:.::.....:...:|.:..|| :::::..:.||
Mouse   902 GQHPDPIYNACFT--TSTKPIRLECSAFFSFYKKNVDYETFKAFNDACLVYDG-RLVIDTTFHTN 963

  Fly  1040 DPDVYAAGSFIKM--RITPN-YQYKFVSERELARKILHHLGIVTDKNFEDRFAEPVLFQAILPLR 1101
            |..:.||||..|.  |...| :.:...|.:|:..::...:..:.|...|.....|.....::|: 
Mouse   964 DIAIRAAGSLTKFSNRYYSNEWTHSNFSSKEIGFQLAAAMLSLFDPTLEPVTEPPADLDRLIPM- 1027

  Fly  1102 YFITKV---TMP--RRYLLSQVPVIKN-CNLT-------------TYKNKTFCRVGLSTRMMVDE 1147
            |...|:   .:|  ..||....|.|.. .||.             ..|..|:.|:.::...:|:.
Mouse  1028 YKGAKIQGGILPGSYHYLHISKPAIPTPLNLQRSQPDFGSDVVTGNAKKGTYFRLYINNYKLVEA 1092

  Fly  1148 IVVVTKKECNLDFLLYFCGKHELLLNKLKSRYRANLIHCFLKFFQEPWTELIMHDDFEELQAENK 1212
            |...:|:.......:...|:||.:||.|.:|:...||.....:|.|||...:.||.|.:|:.|.:
Mouse  1093 ITCFSKEPFPSSNYIRLFGQHEQVLNNLCTRFDDKLIPDLYSYFTEPWCMALFHDRFIDLKKELR 1157

  Fly  1213 ELLSPMAISALSRPGRGALGELTDMDFFTLNKRYIELKLLTFLREHRRDFRHKFALPEDFLKLDL 1277
            ::|  ::.....:|....:....:.:...||:     |...:|:....|..:|..|.:..  ||.
Mouse  1158 QIL--ISKQEEDKPTMEEIAYRLEEEEINLNE-----KPQKYLQRVFEDSIYKSLLEKSI--LDY 1213

  Fly  1278 ADYERY 1283
            ..|.:|
Mouse  1214 LHYNQY 1219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30275NP_788430.3 DUF4821 5..279 CDD:292710 56/281 (20%)
Cfap61NP_001356050.1 DUF4821 15..268 CDD:339606 55/273 (20%)
NirB 660..>779 CDD:224171 32/141 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C325431695
eggNOG 1 0.900 E1_2CMWM
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 185 1.000 Inparanoid score I3910
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004774
OrthoInspector 1 1.000 T616086
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21178
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5804
TreeFam 00.000 Not matched by this tool.
99.020

Return to query results.
Submit another query.