DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30275 and cfap61

Sequence 1:NP_788430.3 Gene:CG30275 FlyBaseID:FBgn0050275 Length:1298 Species:Drosophila melanogaster
Sequence 2:NP_001072512.1 Gene:cfap61 XenbaseID:XB-GENE-5796298 Length:1237 Species:Xenopus tropicalis

Alignment Length:1370 Identity:280/1371 (20%)
Similarity:527/1371 (38%) Gaps:275/1371 (20%)


  Fly    22 RSPGVKWFGNIRPKFRGKDSLFNSYQTYRIL-------AFCTESSALVAYAEFRNYPSIAALPTD 79
            |:..:...|.|:.|....:.:|.......:|       ...:..:.:||.|...:||:...:...
 Frog    18 RTESLDVHGIIKRKTTTTERIFGRVNVIYLLEKANLAVTVYSAKNGVVANAVLLDYPNCDIVDQA 82

  Fly    80 CWLEWLSTRYCLSMSISWLNALFFNFCVYKSDQSPVLVEIIKDVLYRESRVWFLITVRCPYVPQP 144
            .|.|.|.|.|....:.:.||.||.:..|.|.:.|...::.|..|::..:          ||    
 Frog    83 EWEEKLPTHYEELSNCTPLNTLFLHLFVAKDEYSEQCIQEIIRVVFNTA----------PY---- 133

  Fly   145 IHFVETFDDLEK-----ISQVFYPLE-YSMDKNNNTQSLYIVDRFVILPRITYRKALAEDNDDII 203
            :||:......::     :..||...: .|........|||:..|....|::..|.|..||.||:|
 Frog   134 LHFICLTAPRDEALGLALGSVFQQTKIVSASALAKQHSLYMCHRHNHCPQLYVRNARVEDYDDLI 198

  Fly   204 AMQEVENPEMREELGDYYIAEEVMGQNPKSMLVVAETINQSQESEMAIFLWLSSDIDIMFYVRNY 268
            .:....|..::...|::::||.:..|:.:|..:|:|     .:.:...|:.:||:|:.......:
 Frog   199 PIFMRHNDTLKATYGEFFLAELIEAQDEQSHAIVSE-----DKGKAVGFMSVSSEINARLLQSCF 258

  Fly   269 EMEQFGNLVKPADGRSFHYETMTVSSVQRRAEASMFTADALDDLNAVTILGGLQKVDSGMSVASL 333
            ::..|..|.||      |.:....:||:...|..:.                |.:.||..|.|:|
 Frog   259 DLGPFHGLCKP------HPDDSLYASVKTSIEKDLM----------------LSRQDSKTSAAAL 301

  Fly   334 GKM----------KVSSIGGTI-----------------------VDTNVANENKFYMRECLYSK 365
            .:.          |:.|....|                       |..:.|.::....|.|    
 Frog   302 SQQDNIDHNTTDEKIDSTNDAITVSTGNDTMGPREEDTLQEPNDLVSRDPAADDAIQTRNC---- 362

  Fly   366 FKYILEKLHSTDYYLRHEQSVINFIYPAGTEPAGPAAMAAASNVFLLRCIVARQDFPLPRLFNAM 430
                           |..:|..|........|.....:.|.|  ..|.||..:.:   .|..:.:
 Frog   363 ---------------RAPESGSNAAESQHPHPVYKGDVTAFS--IQLFCIDEKHE---SRSVDFL 407

  Fly   431 VAIFSAYPDRDYCMMLMSVKYKASKSYLEVMQYFMPVASRPSNLSSL-DDVFITHRSTIFGEISL 494
            ...||.:||:|:|  :::|.:...:  ..::|.|:.|.  |.:..:| .::::.||:.:...|.:
 Frog   408 SYAFSLFPDKDFC--VITVPHLTPE--FPLLQNFVRVV--PLSTCTLSQELYVFHRAALISSIKV 466

  Fly   495 YKLEKEDVAHVHKLALGNLPSNTQTPNSSSSSFSYCSKVNEREELEHELHVLDAIMKDVLENEFS 559
            ..:...|:.::..|                     ...::.:|.:..:|.:.:...:|   ::.:
 Frog   467 RAVRSNDIHNIRSL---------------------LETLHPQESILGDLQIYNQARRD---DDGT 507

  Fly   560 EFAVFTIRCGISTRSVRENTAIGFVIVREFHSHEKLFEHYHLPKQEYQLNRRRAE----IISLRL 620
            ....|.....        |..:|..::|.....|.:..||::....| .|..:.|    :....|
 Frog   508 PVQAFVAEVA--------NQIVGVSVIRNEKDIEYIHSHYNIEDFIY-FNHHQWEEHGHLHHFAL 563

  Fly   621 HPLFLVSAGLIFRDLAR---KTSFYDYYFIHSVDGYKYSN----DLKKMMMVVEPKPIKKVPVFT 678
            :|:|:.......:::.|   |::.| |....|.:..::.|    .|...:..:.|...::..||.
 Frog   564 NPIFMHFGRHFLKEILRLSHKSALY-YPIYPSCNKEQFKNPCAHSLSSALHYMVPVRPRRQIVFP 627

  Fly   679 RVQANHKKPRKKLDLPPPNFSRDNLIIYRHKLNPVKWFTNSQKLVIIGFSAVTKAFLRQLVFQWN 743
            ..:.....|.|::....|::|.::   :..||......|.:.::|::|.|.|..:|:..|||   
 Frog   628 LEKLGINAPSKQVSKDQPSYSLNH---FNRKLTLEPKVTINARIVVVGASEVGISFMETLVF--- 686

  Fly   744 SKDHKNSENFTCLTRLQVTVICRAGIVEADYDSLFKCPYCTNRQGCYLSYRNESCYVRDCCMRID 808
             ..|....|        :|:|...|:.|       ..|..|...| :|| .:.|...:|..: :.
 Frog   687 -CPHLKFNN--------ITLISSTGLPE-------NTPISTQEHG-FLS-TSHSYNDKDYAL-MS 732

  Fly   809 LRCWVHFVPGKVEKVDRDKKFVKL-DSCEIYYDTLLLMCDRMFVLRC---IDV---------PVY 860
            ||.||:.|.||:..:||..|||.: :..::.||.|:|...:.:.:.|   .||         ||.
 Frog   733 LRSWVNVVVGKMSGIDRAAKFVIVANGRKVPYDHLILCTGQQYQVPCPTEADVRKLLTNKEAPVS 797

  Fly   861 SPR------PCNLVEINFRLN--KFLLFYKVRALLEDMPRTYLVLVYGNNLHTYECIAFLIGHGV 917
            |.:      |.||..:..|.:  ..:.|.|...:.::..    |:||||.|..|..::.|:..|:
 Frog   798 SNQRYTGKIPSNLFTLQNRQDCLAAMRFLKDSVVKQEGN----VIVYGNTLDCYTTLSTLLSLGI 858

  Fly   918 DCSRMVFVQPHRITGRDADMKEKCPYWDKNLQMIMDDILVEKGVNIFTDYDFHHYNLHKSTDFIM 982
            ..||:..|||      ...|...| :.:..::..:...|:.:|::.:.:.....:|.....|   
 Frog   859 SGSRIHLVQP------PLTMNVTC-FNNYAIEEAVQKALLAEGISSYCNCVLAQWNDGAHPD--- 913

  Fly   983 EVIFQHFPTQ-KQMTFECDLFISFQEGHLHQRHKQWLENAGIELDGNQILVNERYQTNDPDVYAA 1046
            .:.|..|.:. |.:..:|..|.:|....:.....:.:.:|.:..|| :::::..:.|||..:.||
 Frog   914 PICFATFTSDTKPLRLQCSAFFNFSRKSVDYEAFKAINDACLVYDG-RLVIDTTFHTNDDSIRAA 977

  Fly  1047 GSFIKMR---ITPNYQYKFVSERELARKILHHLGIVTDKNFE---------DR----FAEPVLFQ 1095
            |:..|..   ....:.:...|.:|:..::..::..:.|...|         ||    :..||:..
 Frog   978 GTLTKYSNRYHASEWSHSNFSSKEIGFQLAANMLNIFDPTLEPVIEFTDEFDRLIPIYKGPVIQG 1042

  Fly  1096 AILP--LRYF-ITK--VTMPRRYLLSQVPVIKNCNLTTYKNKTFCRVGLSTRMMVDEIVVVTKK- 1154
            .|:|  ..|. :.|  :..|.:..::|....:.....:..:..:.|:.::...||:.|..:::| 
 Frog  1043 GIIPGGFHYLHVNKPAIPCPLKAQMAQAHYGREIVTGSAVDGDYFRLHINQYNMVESITCLSQKP 1107

  Fly  1155 --ECNLDFLLYFC--GKHELLLNKLKSRYRANLIHCFLKFFQEPWTELIMHDDFEELQAENKELL 1215
              |.|     |.|  |.||.|||.|.:|:...||.....:|.:.|...|.||.|.:.|.|.:|:|
 Frog  1108 FPESN-----YICLYGHHERLLNNLCARFDEGLIKDLYSYFMKAWCMAIYHDRFIDFQQEVREML 1167

  Fly  1216 SPMAISALSRPGRGALGELTDMDFFTL----------------NKRYIELKLLTFLREHRRDFRH 1264
            :  |.....||....|.:....|...|                :|:.||.|:|.:| .:..:...
 Frog  1168 A--AEQGEGRPSMKQLAQQIADDELNLKEQPRQYLKRILEENGHKKEIERKILNYL-NYNSNHLS 1229

  Fly  1265 KFALP 1269
            .||.|
 Frog  1230 MFARP 1234

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30275NP_788430.3 DUF4821 5..279 CDD:292710 59/270 (22%)
cfap61NP_001072512.1 DUF4821 15..273 CDD:292710 61/280 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C325433699
eggNOG 1 0.900 E1_2CMWM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D120508at33208
OrthoFinder 1 1.000 FOG0004774
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.