DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30275 and CG30268

Sequence 1:NP_788430.3 Gene:CG30275 FlyBaseID:FBgn0050275 Length:1298 Species:Drosophila melanogaster
Sequence 2:NP_611712.2 Gene:CG30268 FlyBaseID:FBgn0050268 Length:1240 Species:Drosophila melanogaster

Alignment Length:1315 Identity:431/1316 (33%)
Similarity:702/1316 (53%) Gaps:146/1316 (11%)


  Fly    18 NKLIRSPGVKWFGNIRPKFRGK-------------DSLFNSYQTYRILAF-CTESSALVAYAEFR 68
            |.||.:.|::....|...:..|             |:||...|..|::.: ..|...|:||:||.
  Fly     7 NILIVTAGIRDQRRIEDLYDAKSTWHFGVKETPPLDTLFLKNQAQRLIVYNKQEYHLLLAYSEFA 71

  Fly    69 NYPSIAALPTDCWLEWLSTRYCLSMSISWLNALFFNFCVYKSDQSPVLVEIIKDVLYRESRVWFL 133
            |:|:|..|..|.||.||:.|:|:.:.|:.|||:||||.:.|...|.:|.::|.:|.|.|..|.::
  Fly    72 NHPNIPVLANDLWLHWLNVRFCVDLPITLLNAIFFNFFICKDGHSQMLKKVILEVFYTEHLVNYM 136

  Fly   134 ITVRCPYVPQPIHFVETFDDLEKISQVFYPLEYSMDKNNNTQSLYIVDRFVILPRITYRKALAED 198
            :..:.|..|.     ..:|.::.....:||....:.:..:..::.::.|...:|.:::||||.||
  Fly   137 LVFKPPDCPP-----GQYDAVQAFGTTYYPKHSKVSEQKHLPAVIVIQRRSTMPVLSFRKALPED 196

  Fly   199 NDDIIAMQEVENPEMREELGDYYIAEEVMG-------QNPKSMLVVAETINQSQESEMAI----- 251
            ||||:.|.:.|:||:|::.||:||||.::.       .|.|  :::||.     |.|:|.     
  Fly   197 NDDIVEMIDSEDPELRKKHGDFYIAEHLLNAEGSDSDHNDK--IIIAEF-----EEEIADNVKGA 254

  Fly   252 -FLWLSSDIDIMFYVRNYEMEQFGNLVKPADGRSFHYETMTVSSVQRRAEASMFTADALDDLNAV 315
             .:|||..:||.....||.:|:.||||:...|.:..:....|.||:.::...:||...:::..  
  Fly   255 GLMWLSQSLDIKMLATNYHLERLGNLVRYTPGCTHAHVGFEVISVELKSYKELFTRKQMEERY-- 317

  Fly   316 TILGGLQKVDSGMSVASLGKMKVSSIGGTIVDTNVANENKFYMRECLYSKFKYILEKLHSTDYYL 380
                               |..||.|     :|:..:|.    |..|:.|:|:|.|:|....||:
  Fly   318 -------------------KSHVSRI-----NTDGQDET----RNILFKKYKHIYEELREGVYYI 354

  Fly   381 -RHEQSV-INFIYPAGTEPAGP---AAMAAASNVFLLRCIVARQDFPLPR---LFNAMVAIFSAY 437
             .|:..: |:|..|.|.:....   ..:|.|||.|||:..   |..||.|   .|.::.|:|||:
  Fly   355 TAHQDKLEISFDLPDGEKSTSENRLQYLAKASNGFLLKMF---QLHPLVRYEYTFYSLSAMFSAF 416

  Fly   438 PDRDYCMMLMSVKYKASKSYLEVMQYFMPVASRPSNLSSLDDVFITHRSTIFGEISLYKLEKEDV 502
            ||.|||:.|:......|....|::::|:|||.|||:..| :::|:.||||:|||:.:::.|.:::
  Fly   417 PDHDYCVTLVPANVSTSPCQRELLRFFLPVAHRPSSTVS-ENLFVAHRSTLFGELRVHRFESQEI 480

  Fly   503 AHVHKLALGNLPSNTQTPNSSSSSFSYCSK--VNEREELEHELHVLDAIMKDVLENEFSEFAVFT 565
            ..:..|    :....:...|.|...|..||  .|..|::   |.:.:.|::::||:...:...||
  Fly   481 DEIRTL----ISKQARKRESLSEDDSEDSKGIDNYTEDV---LSIFEDIIREILEDPMCDLTCFT 538

  Fly   566 IRCGISTRSVRENTAIGFVIVREFHSHEKLFEHYHLPKQEYQLNRRRAEIISLRLHPLFLVSAGL 630
            ||||.|.:.. :...:||:|:|.|..::.:.:.:.:|:.::.|..:|.||:..||||.|.:....
  Fly   539 IRCGQSKKHT-DCPLVGFIILRPFLVYDDISKIFMMPRDQFSLTHKRGEIVMFRLHPFFQMWCKT 602

  Fly   631 IFRDLARKTSFYDYYFIHSVDGYKYSNDLKKMMMVVEPKPIKK-VPVFTRVQANHKKPRKKLDLP 694
            |.|.:|...::.:.|:||...|....|||...||.:||:.:|| :..:..|....:..:.|:.: 
  Fly   603 ILRTVALCDNYRELYYIHFFSGISLPNDLMYNMMPIEPRRMKKNLFNYKCVSLRRRVAKGKMSV- 666

  Fly   695 PPNFSRD----NLIIYRHKLNPVKWFTNSQKLVIIGFSAVTKAFLRQLVFQWNSKDHKNSENFTC 755
              |.|.|    .:.::.|.|.|.........|:|:|||:...||||.::|.|||||..|.:.:.|
  Fly   667 --NVSMDICTSRMRLFCHNLQPTMHMGGKNSLLIVGFSSTCMAFLRTVIFAWNSKDLINYKKYNC 729

  Fly   756 LTRLQVTVICRAGIVEADYDSLFKCPYCTNRQGCYLSYRNESCYVRDCCMRIDLRCWVHFVPGKV 820
            |..:.:||:...||:|:.||..|.|.:|.|.:.||:...|.:.:|||...|:|:|.||.||.|:|
  Fly   730 LPMVDITVLVGHGIIESAYDCDFSCNFCANARNCYVDTGNVNPFVRDTMQRMDVRHWVRFVSGEV 794

  Fly   821 EKVDRDKKFVKL-DSCEIYYDTLLLMC-------DRMFVLRCIDVPVYSPRPCNLVEINFRLNKF 877
            :.:.|.:|.|:| |.|.:|||.|:||.       |:.|        ...|.|.|.|..|.||::.
  Fly   795 KSIKRQEKVVELSDGCHLYYDKLVLMGATRYGFEDKEF--------KGHPIPLNYVVNNTRLDRI 851

  Fly   878 LLFYKVRALLEDMPRTYLVLVYGNNLHTYECIAFLIGHGVDCSRMVFVQPH-RITGRDADMKEKC 941
            :.::||..::|.| .:|.::|||.||..||||.||:.||.....:::|||| .|...|..:.|| 
  Fly   852 IFYHKVCEMVELM-ESYYIIVYGYNLCIYECIHFLVTHGCKAQNIIYVQPHVPIVMEDLGIPEK- 914

  Fly   942 PYWDKNLQMIMDDILVEKGVNIFTDYDFHHYNLHKSTDFIMEVIFQHFPTQKQMTFECDLFISFQ 1006
               |..|..|:.:::.:.||.|:...::..:.|.:....|.:|.....|::|::...||||:::.
  Fly   915 ---DSRLDPIILEMIADLGVTIYLSTNYSQFILSQDNMNIEKVELIMHPSKKKIVLHCDLFVNYN 976

  Fly  1007 EGHLHQRHKQWLENAGIELDGNQILVNERYQTNDPDVYAAGSFIKMRITPNYQYKFVSERELARK 1071
            :..:....:..|..||||:...:|:||.||.|||.:::|||..:.|...||:||.:.|.:|:|.|
  Fly   977 DNTISSSMENVLSEAGIEISERRIVVNSRYCTNDRNIFAAGINVIMIPKPNFQYTYGSPQEMAEK 1041

  Fly  1072 ILHHLGIVTDKNFEDRFAEPVLFQAILPLRYFITKVTMPRRYLLSQVPVIKNCNLTTYKNKTFCR 1136
            :.:.|.:: ....:.|:::|.:|..|||:.|.|.|:|.|:..|:.|:|:..:..||||.:..|||
  Fly  1042 LAYELNMI-KVVMQSRYSKPYMFTGILPMGYQIIKITQPKPLLIGQLPIEFSETLTTYDDGDFCR 1105

  Fly  1137 VGLSTRMMVDEIVVVTKKECNLDFLLYFCGKHELLLNKLKSRYRANLIHCFLKFFQEPWTELIMH 1201
            :.|:.:::|.|||.||||...|.|:.||||||.:|||.|:.|::|..|..||.|||:|||||:||
  Fly  1106 IRLNNKLIVIEIVCVTKKPKRLYFMEYFCGKHAMLLNDLRGRFQAGWIQNFLDFFQQPWTELLMH 1170

  Fly  1202 DDFEELQAENKELLSPMAISALSRPGRGALGELTDMDFFTLNKR---------YIELKLLTFLRE 1257
            |.||:||.:|:.||..|.:             :.:.|  |.|.|         .:|..::.|:|.
  Fly  1171 DRFEDLQLKNRRLLLSMLL-------------MNNKD--TNNPRNSLENTQRLRLEENVIDFVRT 1220

  Fly  1258 HRRDFRHKFALPEDF 1272
            :|:||.|:||||||:
  Fly  1221 YRKDFTHEFALPEDW 1235

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30275NP_788430.3 DUF4821 5..279 CDD:292710 91/288 (32%)
CG30268NP_611712.2 DUF4821 14..286 CDD:292710 88/284 (31%)
Pyr_redox_2 <793..1017 CDD:285266 78/237 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C325421273
eggNOG 1 0.900 E1_2CMWM
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I4197
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D120508at33208
OrthoFinder 1 1.000 FOG0004774
orthoMCL 1 0.900 OOG5_131204
Panther 1 1.100 P PTHR21178
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5804
87.920

Return to query results.
Submit another query.