DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30275 and Cfap61

Sequence 1:NP_788430.3 Gene:CG30275 FlyBaseID:FBgn0050275 Length:1298 Species:Drosophila melanogaster
Sequence 2:XP_008760509.1 Gene:Cfap61 RGDID:1311519 Length:1248 Species:Rattus norvegicus

Alignment Length:1369 Identity:283/1370 (21%)
Similarity:532/1370 (39%) Gaps:253/1370 (18%)


  Fly     7 RLAQAGDQDGLNKLIRSPGVKWFGNIRPKFRGKDSLFNSYQTYRILAFCTESSALVAYAEFRNYP 71
            |..::.|...:..|||....|.||.:       :.::...:....:..|.:...::|::.|.:||
  Rat    30 RRTESQDIFCIKTLIRKFTQKLFGRL-------NIIYLLEKANLAVTVCNDKEEIMAHSIFVDYP 87

  Fly    72 SIAALPTDCWLEWLSTRYCLSMSISWLNALFFNFCVYKSDQSP-VLVEIIKDVLYRESRVWFLIT 135
            :......|.|:. :.......:..:.||.||.:|.|...:.:. .|.|||:.|......::|:..
  Rat    88 NWNVAKQDNWIP-VFRELDKEIPCTPLNTLFMHFFVAVDEYATGCLKEIIRTVFKAVPELYFIFL 151

  Fly   136 VRCPYVPQPIHFVETFDDLEKISQVFYPLEYSMDKNNNTQSLYIVDRFVILPRITYRKALAEDND 200
            :...|:......:..||.:..|..:.|..|:         :::|..|....|::..|||..||:|
  Rat   152 IVPTYLSLGSTLITVFDQVGNIPCMNYDEEF---------AVHICHRHDHYPQLHIRKARVEDHD 207

  Fly   201 DIIAMQEVENPEMREELGDYYIAEEVMGQNPKSMLVVAETINQSQESEMAIFLWLSSDIDIMFYV 265
            |::.:....:..::|..|:|::||.:..|:..:..||.|.     |.:...|:.:.:.:::....
  Rat   208 DLMPIFMHYDSTLKEIYGEYFLAELIEAQDEDNHAVVCEV-----EGKAVGFMSVCASVNLPLLH 267

  Fly   266 RNYEMEQF--------GNLVKPADGRSFHYETMT-----VSSVQRRAE--ASMFTADALDDLNAV 315
            ..:::..|        .:|::|....|......|     ....||..|  .|:.|::.:.:.:..
  Rat   268 ECFDLGPFHGFCFPHPDDLLEPPKEPSLEESEDTGNKSDSQGSQRVVEEPVSIDTSEMIQEKDTE 332

  Fly   316 T------ILGGLQKV-------DSGMSVASLGKMKVSSIGGTIVDTNVANENKFYMRECLYSKFK 367
            |      :|..|.||       :..:|:.||                 .:|:.|.....|.|...
  Rat   333 TSISCEEVLSLLSKVSEDMQDLEKNLSIISL-----------------VDEDDFGSLSSLSSSLL 380

  Fly   368 YILEKLHSTDYYLRHEQSVINFIYPAGTEPAGPAAMAAASNVFLLRCIVARQDFPLPRLFNAMVA 432
            ..:|..|....||..                      :|:....|.||..|.:   .|..:.|..
  Rat   381 LSVESSHFRPLYLGE----------------------SAAFCIQLFCIDERYE---ARSLDFMSF 420

  Fly   433 IFSAYPDRDYCMMLMSVKYKASKSYLEVMQYFMPVASRPSNLSSLD-DVFITHRSTIFGEISLYK 496
            :||.:|::::|  |:||.:...:..|  :|.|:.|.  |.:..:|| |:::.||:.:...|::..
  Rat   421 VFSLFPNKNFC--LISVPHLTPEFVL--IQNFVKVV--PFSNCTLDNDLYVFHRAGLLRSITIRL 479

  Fly   497 LEKEDVAHVHKLALGNLPSNTQTPNSSSSSFSYCSKVNEREELEHELHVLDAIMKDVLENEFSEF 561
            .:..|...|.||        .:|...|:...|..::.||...                :.:.:|.
  Rat   480 AKFLDTPGVEKL--------VRTLLLSTKILSDLAQYNEAGR----------------DPDGTEL 520

  Fly   562 AVFTIRCGISTRSVRENTAIGFVIVREFHSHEKLFEHYHLPKQEYQLNRRRAE---IISLRLHPL 623
            .||.....        |..:|..::|:....|.:..||::....|..:.::.|   :....|:|:
  Rat   521 QVFVAEVA--------NQIVGIAVIRKEMDIEYIRSHYNIEDFIYFSHHQQEEHGRLNHFALNPI 577

  Fly   624 FLVSAGLIFRDLAR---KTSFYDYYFIHSVDG---YKYSNDLKKMMMVVEPKPIKKVPVFTRVQA 682
            |........:::.|   |:..|...:..:.:|   ..|::.|...:..:       |||..|.|.
  Rat   578 FRHYTKFFLKEILRLGYKSCLYYPVYSQTREGKLQSSYAHSLTSALHYL-------VPVRPRRQI 635

  Fly   683 NHKKPRKKLDLPPPNFSRDN----LIIYRHKLNPVKWFTNSQKLVIIGFSAVTKAFLRQLVFQWN 743
            .:...:..::.|....|:|.    |.....||......|.:.::|::|.|:|..:||..|||   
  Rat   636 VYPLEKLGINAPSKEVSKDQASYALNHTNRKLTLEPKVTVNARIVVVGASSVGISFLETLVF--- 697

  Fly   744 SKDHKNSENFTCLTRLQVTVICRAGIVEADYDSLFKCP---YCTNRQGCYLSYRNESCYVRDCCM 805
             ..|....|        :|:|...|:           |   ..:|.|..:|:  ::.|:.....:
  Rat   698 -CSHLKFNN--------LTLISTHGL-----------PGKKLLSNEQRKFLA--SDHCFNDKDYV 740

  Fly   806 RIDLRCWVHFVPGKVEKVDRDKKFVKLDSCEI-YYDTLLLMCDRMFVLRC------------IDV 857
            .:.|..||:.|.|::..:||..|.|.:...|| :||.|:|...:.:.:.|            .:|
  Rat   741 LMSLCSWVNVVVGRMTAIDRVAKQVVVSKDEIVFYDHLILCTGQQYQVPCPTGADIEQHLTNREV 805

  Fly   858 PVYSPR------PCNLVEINFRLNKFLLFYKVRALLEDMPRTYL----VLVYGNNLHTYECIAFL 912
            ...|.|      |.||..:|...:      .||||......:.|    |:||||.|..|..:..|
  Rat   806 MQLSKRRYTGTVPSNLFILNDEED------CVRALFWLRNNSTLTEGKVIVYGNTLDAYTTVETL 864

  Fly   913 IGHGVDCSRMVFVQPHRITGRDADMKEKCPYWDK-NLQMIMDDILVEKGVNIFTDYDFHHYNLHK 976
            :..|::.:.:.||.|        ..:....|.:. :::..:|:.|...||.::.|.....:|..:
  Rat   865 LHIGMEGNCIYFVHP--------PAESNTTYINNYDIESAVDEALSAAGVKVYQDALLAQWNQGQ 921

  Fly   977 STDFIMEVIFQHFPTQKQMTFECDLFISFQEGHLHQRHKQWLENAGIELDGNQILVNERYQTNDP 1041
            ..|.|....|.  .:.|....||..|.||.:.::.....:...:|.:..|| :::::..:.|||.
  Rat   922 DPDPIQNACFT--TSTKPFRLECSAFFSFYKKNVDYETFKAFNDACLVYDG-RLVIDTTFHTNDI 983

  Fly  1042 DVYAAGSFIKM--RITPN-YQYKFVSERELARKILHHLGIVTDKNFEDRFAEPVLFQAILPLRYF 1103
            .:.|||...|.  |...| :.:...|.:|:..::...:..:.|...|.....|.....::|: |.
  Rat   984 AIRAAGPLTKFSNRYYSNEWTHSNFSSKEIGFQLAAAMLSLFDPTLEPVTEPPADLDRLIPM-YK 1047

  Fly  1104 ITKV---TMP--RRYLLSQVPVIK------------NCNLTT--YKNKTFCRVGLSTRMMVDEIV 1149
            ..|:   .:|  ..||....|.|.            ...:.|  .|..|:.|:..:...:|:.|.
  Rat  1048 GAKIQGGILPGSYHYLHISKPAIPTPLDVQRSQPDFGSEIVTGNAKKGTYFRLYFNNYKLVEAIT 1112

  Fly  1150 VVTKKECNLDFLLYFCGKHELLLNKLKSRYRANLIHCFLKFFQEPWTELIMHDDFEELQAENKEL 1214
            ..:|:.......:...|:||.:||.|.:|:...||.....:|.|||...:.||.|.:|:.|.:::
  Rat  1113 CFSKEPFPTSNYIRLFGQHEQVLNNLCTRFDEKLIPDLYSYFTEPWCMALFHDRFIDLKKELRQI 1177

  Fly  1215 LSPMAISALSRPGRGALGELTDMDFFTLNKRYIELKLLTFLREHRRDFRHKFALPEDFLKLDLAD 1279
            ::  :.....:|....:....:.:...||:     |...:|::...|..:|..|.:..  ||...
  Rat  1178 IT--SKQEEDQPTMEQIARQLEEEEINLNE-----KPQKYLQKVFEDSIYKSLLEKSI--LDYLH 1233

  Fly  1280 YERY 1283
            |.:|
  Rat  1234 YNQY 1237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30275NP_788430.3 DUF4821 5..279 CDD:292710 56/281 (20%)
Cfap61XP_008760509.1 DUF4821 28..285 CDD:292710 55/277 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D120508at33208
OrthoFinder 1 1.000 FOG0004774
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.